seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://scconnect.org.uk
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 12 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
2 Warnings
38 Passed
Common SEO issues
Score: 84
Failed: 4
Warnings: 1
Passed: 16
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: ex bt telephone and broadband engineers, Data Cat5 Cat6 network services.
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: ex bt telephone engineers, broadband engineers, 50% CHEAPER, Wi-Fi, Openreach, CCTV, Sky, Virgin Media engineer services, Call: 07547 920645 or 0800 860 6767, installations and repairs, extension socket installation and broadband repairs, Cat5e Cat6, network engineer london, cat5 cat6 network installation companies, telephone technician london, all service providers, slow internet faults fixed, noisy phone line repairs, london network engineers, broadband, WIFI engineers, internet services, sky signal repairs, CCTV engineer london, phone line faults, Installations and repairs. covering london and surrounding areas UK.
Google Search Results Preview
Desktop version
https://scconnect.org.ukex bt telephone and broadband engineers, Data Cat5 Cat6 network services.ex bt telephone engineers, broadband engineers, 50% CHEAPER, Wi-Fi, Openreach, CCTV, Sky, Virgin Media engineer services, Call: 07547 920645 or 0800 860 6767, installations and repairs, extension socket installation and broadband repairs, Cat5e Cat6, network engineer london, cat5 cat6 network installation companies, telephone technician london, all service providers, slow internet faults fixed, noisy phone line repairs, london network engineers, broadband, WIFI engineers, internet services, sky signal repairs, CCTV engineer london, phone line faults, Installations and repairs. covering london and surrounding areas UK.
Mobile version
https://scconnect.org.ukex bt telephone and broadband engineers, Data Cat5 Cat6 network services.ex bt telephone engineers, broadband engineers, 50% CHEAPER, Wi-Fi, Openreach, CCTV, Sky, Virgin Media engineer services, Call: 07547 920645 or 0800 860 6767, installations and repairs, extension socket installation and broadband repairs, Cat5e Cat6, network engineer london, cat5 cat6 network installation companies, telephone technician london, all service providers, slow internet faults fixed, noisy phone line repairs, london network engineers, broadband, WIFI engineers, internet services, sky signal repairs, CCTV engineer london, phone line faults, Installations and repairs. covering london and surrounding areas UK.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
247telephone218engineer63engineers50london46park
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
actonadslareasbarnetbrentbroadbandbromleybromptonbusinesscablecamdencctvcentralchelseachingfordchiswickcolindalecompanycoveredcrossdataealingeastedmontonenfieldengineerengineersessexextrafaultfaultsfibrefinchleyforestgardengategoldersgreengrovehackneyhammersmithhampsteadharrowhendonhillhollowayhornseyinstallationinstallationsinternalinternetislingtonkensingtonlambethlinelocallondonmanormediamobilenetworknorthnorwoodofficeopenreachopticpalaceparkphoneplusnetpostcodesproviderprovidersrepairedrepairsscconnectservicesignalsocketssouthsouthgatespecialiststratfordstreetstructuredsystemstalktelecomtelecomstelephonetesttottenhamtownuppervirginvoipwestwoodwoodfordwoolwich
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
BT Telephone and broadband engineers, telephone extensions, fibre, phone line repairs, bt telephone and broadband engineer ex bt london, network Cat5e Cat6 Cat7
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
1center1font
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
AddThis Facebook Google Plus Twitter 
Speed optimizations
Score: 46
Failed: 6
Warnings: 1
Passed: 9
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 74% - from 93.71 Kb to 24.29 Kb .
Site Loading Speed Test
  • Your website loading time is around 8.2 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 214
  • 16 HTML Pages
  • 37 CSS Files
  • 77 JS Files
  • 84 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF Records Checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:31.220.21.1 +ip4:31.220.21.17 +include:relay.mailchannels.net ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved