seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://rgcsolutions.be
Your general SEO Checkup Score
Archived
64/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 64 out of 100, which is below the average score of 75. However, there are 12 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
12 Failed
0 Warnings
28 Passed
Common SEO issues
Score: 35
Failed: 6
Warnings: 0
Passed: 9
Google Search Results Preview
Desktop version
http://rgcsolutions.be/RGC Solutions - Uw financiële partnerWij zorgen voor een goede begeleiding en professioneel advies.
Mobile version
http://rgcsolutions.be/RGC Solutions - Uw financiële partnerWij zorgen voor een goede begeleiding en professioneel advies.
Keywords Cloud
aankopenaansprakelijkheidaanvragenadresadviesalleanalyserenassurmifidautobasisbedrijvenbegeleidingbestboudewijlaanbouwbuitenlandburgerlijkeconcreetcontactdezedisclaimerdoendooreenmanszaakenigefacebookfamilialefinancieringfiscaalfiscalefsmagedragsregelsgegevensgeldgewaarborgdgoedegrondighomehypothecaireinfoinfo@rgcsolutions.beinkomenjobsjuisteklassiekekomenkoopkredietlaterleentleningleningenlevensverzekeringmaatschappelijkemeermenunaarnavigatienodignodigenooitonafhankelijkonafhankelijkheidonderonzeoptimalisatieoversparticulerenparticulierenpartnerspastprimordiaalprinsprofessioneelrenovatiergcsolutionsserieuzesituatiesteedstweetertypevastgoedvennootschapverkoopverplichtingverstrektverzekeringverzekeringenvoorvoorstelwerknemerswilrijkwoningzaakzekerheidzelfstandigenzetelzoekenzonderzowel
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • We have found one URL that is not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 17 'img' tags and 16 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Congratulations! Your web page does not use inline CSS styles.
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 80
Failed: 3
Warnings: 0
Passed: 8
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 16.98 Kb to 4.33 Kb (75 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 3.309 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 55
  • 1 HTML Pages
  • 6 CSS Files
  • 9 JS Files
  • 39 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and jpcache. Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF Records Checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 include:spf.protection.outlook.com include:_custspf.one.com -all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved