seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://renodesignaz.com
Your general SEO Checkup Score
Archived
93/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 93 out of 100, which is higher than the average score of 75. Our analysis has identified 16 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
16 Failed
4 Warnings
52 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 72
Failed: 5
Warnings: 2
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 69 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Flooring Store servicing Phoenix, AZ | Renovation and Design Concepts
Length: 69 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Call Renovation and Design Concepts in Phoenix, AZ for home renovation and design services. Offering tile services, flooring installation, cabinet design and more.
Length: 163 characters
Google Search Results Preview Test
Desktop version
https://www.renodesignaz.com/Flooring Store servicing Phoenix, AZ | Renovation and Design ConceptsCall Renovation and Design Concepts in Phoenix, AZ for home renovation and design services. Offering tile services, flooring installation, cabinet design and more.
Mobile version
https://www.renodesignaz.com/Flooring Store servicing Phoenix, AZ | Renovation and Design ConceptsCall Renovation and Design Concepts in Phoenix, AZ for home renovation and design services. Offering tile services, flooring installation, cabinet design and more.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Flooring Store servicing Phoenix, AZ | Renovation and Design Concepts
og:description
Call Renovation and Design Concepts in Phoenix, AZ for home renovation and design services. Offering tile services, flooring installation, cabinet design and more.
og:site_name
Renovation and Design Concepts
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
24flooring21tile17browse12services11carpet
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
flooring
tile
browse
services
carpet
Keywords Cloud Test
areaareasbathblendbringbrowsebudgetcabinetscarpetcatalogchoosecommercialcompanyconceptsconsultationcontactcontractorcontractorscountertopscoveringscustomerdatedesigndurabilityeleganceestimateexpertiseextensivefaqsfeaturedfinancingfloorflooringfreefunctionalitygalleriesglasshallmarkhardwoodhelphomehomesinspirationinstallationinstallerskitchenlaminatelocationlookingluxurymatchmaterialsmeetmetalnaturalneedsofferoffersorderphoenixpreferredpremierproductsprofessionalprojectqualityrangereadrenovationrequestrevampreviewsrightroomrugssampleserviceservicesshopshowroomskilledsolidsolutionsspacesspecialistsstartedstonestorestylesurfaceteamtiletimeviewvinylvisitwaterproofwebsitewelcomewindow
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Welcome to Renovation and Design Concepts – Your Premier Flooring Store in Phoenix, AZ
H2 tags
Tile
Cabinets
Countertops
Luxury vinyl
Carpet
Why choose Renovation and Design Concepts?
Shopping made simple
What our clients say about us
Get inspired
Request a free estimate
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
1center
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 72
Failed: 5
Warnings: 1
Passed: 14
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,357 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1677.54 Kb to 219.21 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.0 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
41.0 %
1.10 Mb
image
39.6 %
1.06 Mb
font
8.7 %
238.09 Kb
css
6.2 %
171.51 Kb
html
4.4 %
121.28 Kb
other
0.1 %
3.58 Kb
TOTAL
100%
2.69 Mb
Requests by content type
Content type
Percent
Requests
javascript
44.2 %
57
image
24.0 %
31
css
11.6 %
15
other
10.9 %
14
font
8.5 %
11
html
0.8 %
1
TOTAL
100%
129
Content size by domain
Domain
Percent
Size
res.cloudinary.com
38.7 %
1.04 Mb
googletagmanager.com
14.1 %
387.78 Kb
renodesignaz.com
9.7 %
267.49 Kb
fonts.gstatic.com
8.7 %
238.09 Kb
clientassets.web.broadlume.com
7.9 %
216.80 Kb
adhawk-marketplace-assets.s3-us-west-1.amazonaws.com
4.9 %
135.03 Kb
ka-p.fontawesome.com
3.4 %
93.75 Kb
cdn.dhq.technology
2.8 %
77.96 Kb
connect.facebook.net
2.7 %
74.09 Kb
google-analytics.com
1.9 %
52.71 Kb
Other
5.1 %
141.11 Kb
TOTAL
100%
2.69 Mb
Requests by domain
Domain
Percent
Requests
renodesignaz.com
17.8 %
23
res.cloudinary.com
15.5 %
20
clientassets.web.broadlume.com
14.7 %
19
fonts.gstatic.com
8.5 %
11
cdn.dhq.technology
7.0 %
9
420103.tctm.co
5.4 %
7
sponsors-v2.floorforce.com
5.4 %
7
googletagmanager.com
3.1 %
4
ka-p.fontawesome.com
3.1 %
4
kit.fontawesome.com
2.3 %
3
Other
17.1 %
22
TOTAL
100%
129
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.085 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.085 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.306 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.306 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 6.67 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

6.67 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Visit our showroom
Html: <div class="bs_hp_banner">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0199. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0199

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Visit our showroom
Html: <div class="bs_content">
Score: 0.0123
Server and security
Score: 86
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.renodesignaz.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.renodesignaz.com
Subject Alternative Names (SANs)
*.renodesignaz.com
Not valid before
Tue, September 3o 2024, 12:00:00 am (z)
Not valid after
Thu, October 2o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon RSA 2048 M03
Intermediate certificate
Common name
Amazon RSA 2048 M03
Organization
Amazon
Location
US
Not valid before
Tue, August 23o 2022, 10:26:04 pm (z)
Not valid after
Fri, August 23o 2030, 10:26:04 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.renodesignaz.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.renodesignaz.com" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved