seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://psychiatristuae.com
Your general SEO Checkup Score
Archived
95/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 95 out of 100, which is higher than the average score of 75. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
5 Warnings
57 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 77
Failed: 2
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 84 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Dr. Zoheb Raj | Expert Psychiatrist in Ajman & Sharjah, UAE | Mental Health Services
Length: 84 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Dr. Zoheb Raj, a European Board Fellow, provides compassionate psychiatric care in Ajman & Sharjah, UAE. Specializing in depression, anxiety, ADHD, child mental health, and therapy.
Length: 181 characters
Google Search Results Preview Test
Desktop version
https://psychiatristuae.com/Dr. Zoheb Raj | Expert Psychiatrist in Ajman & Sharjah, UAE | Mental Health ServicesDr. Zoheb Raj, a European Board Fellow, provides compassionate psychiatric care in Ajman & Sharjah, UAE. Specializing in depression, anxiety, ADHD, child mental health, and therapy.
Mobile version
https://psychiatristuae.com/Dr. Zoheb Raj | Expert Psychiatrist in Ajman & Sharjah, UAE | Mental Health ServicesDr. Zoheb Raj, a European Board Fellow, provides compassionate psychiatric care in Ajman & Sharjah, UAE. Specializing in depression, anxiety, ADHD, child mental health, and therapy.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
10الدكتور9health8mental8النفسي8العقلية
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
الدكتور
health
mental
النفسي
العقلية
Keywords Cloud Test
advancedajmanbackgroundblogsboardcalicutcarecenterchildclinicalclinicscollegecompletedcomprehensiveconsultationscontactdegreedirectoreducationaleuropeanexperienceexperiencedextensivefellowfieldfollowinghavinghealthhelphighlyindiainfointernationaljubileekannurkeralakmctlanguagemedicalmentalmentalhealthmessagemissionnamineuropsychiatricneuropsychiatryobtainedpatientspsychiatristpsychiatrypursuedqualifiedrichryanryanajmansciencesscreeningselfsharjahspecialisttoggletrainingtreatmentuniversityvisitwhatsappzohebأخصائياتصلاستشاراتالأوروبيالدكتورالدوليةالصحةالطبالطبيالطبيةالعصبيالعقليةالعيادةاللغةالمجلسالنفسيالهندالواسعةتقديمجامعةخبرةرعايةريانزهيبعاليةعجمانعلاجعياداتكليةكيرالامركزواتسابيعكس
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
الدكتور زهيب راج
H2 tags
About Dr. Zoheb Raj
Services Offered
Why Choose Dr. Zoheb Raj?
The Practice
Book an Appointment
Contact Us
Follow Us
Visit Us
عن الدكتور زهيب راج
الخدمات المقدمة
لماذا تختار الدكتور زهيب راج؟
العيادة
حجز موعد
اتصل بنا
تابعنا
موقع العيادة
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="utf-8"
Speed optimizations
Score: 82
Failed: 2
Warnings: 2
Passed: 16
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 10.0 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 184 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 41.19 Kb to 10.0 Kb (76% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.71 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
88.3 %
2.56 Mb
javascript
9.8 %
290.92 Kb
font
1.6 %
47.83 Kb
html
0.2 %
5.90 Kb
css
0.0 %
1.12 Kb
other
0.0 %
0 B
TOTAL
100%
2.90 Mb
Requests by content type
Content type
Percent
Requests
image
60.0 %
9
javascript
20.0 %
3
html
6.7 %
1
css
6.7 %
1
font
6.7 %
1
other
0.0 %
0
TOTAL
100%
15
Content size by domain
Domain
Percent
Size
i.imgur.com
88.3 %
2.56 Mb
googletagmanager.com
5.1 %
152.70 Kb
cdn.tailwindcss.com
4.2 %
123.68 Kb
fonts.gstatic.com
1.6 %
47.83 Kb
static.elfsight.com
0.5 %
14.54 Kb
psychiatristuae.com
0.2 %
5.90 Kb
fonts.googleapis.com
0.0 %
1.12 Kb
TOTAL
100%
2.90 Mb
Requests by domain
Domain
Percent
Requests
i.imgur.com
60.0 %
9
psychiatristuae.com
6.7 %
1
fonts.googleapis.com
6.7 %
1
googletagmanager.com
6.7 %
1
cdn.tailwindcss.com
6.7 %
1
static.elfsight.com
6.7 %
1
fonts.gstatic.com
6.7 %
1
TOTAL
100%
15
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.061 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.061 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.895 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.895 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.9 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.9 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Dr. Zoheb Raj is a highly qualified, Fellow of the European Board and experience...
Html: <p class="text-justify mb-4">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0004. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0004

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0004
Server and security
Score: 59
Failed: 4
Warnings: 0
Passed: 3
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "psychiatristuae.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
psychiatristuae.com
Subject Alternative Names (SANs)
psychiatristuae.com, www.psychiatristuae.com
Not valid before
Mon, May 19o 2025, 12:00:00 am (z)
Not valid after
Tue, May 19o 2026, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 37
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://psychiatristuae.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://psychiatristuae.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:104.219.248.236 +ip4:198.54.114.224 include:spf.web-hosting.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved