seo site checkup logo
PricingFree ToolsArticles
Report generated 4 hours ago
https://pitit.eu
Your general SEO Checkup Score
Archived
88/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 88 out of 100, which is higher than the average score of 75. Our analysis has identified 6 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
1 Warnings
54 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 94
Failed: 1
Warnings: 1
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: pitit - Email Marketing - Email Campaign Manager
Length: 48 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 143 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Beheer je email campagnes en nieuwsbrieven met je eigen Amazon SES backend. Lage kosten, hoge deliverability, volledige controle. Start gratis!
Length: 143 characters
Google Search Results Preview Test
Desktop version
https://pitit.eu/pitit - Email Marketing - Email Campaign ManagerBeheer je email campagnes en nieuwsbrieven met je eigen Amazon SES backend. Lage kosten, hoge deliverability, volledige controle. Start gratis!
Mobile version
https://pitit.eu/pitit - Email Marketing - Email Campaign ManagerBeheer je email campagnes en nieuwsbrieven met je eigen Amazon SES backend. Lage kosten, hoge deliverability, volledige controle. Start gratis!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
pitit - Email Marketing - Email Campaign Manager
og:description
Beheer je email campagnes en nieuwsbrieven met je eigen Amazon SES backend. Lage kosten, hoge deliverability, volledige controle. Start gratis!
og:url
https://pitit.eu
og:type
website
og:site_name
pitit - Email Marketing
og:locale
nl_NL
og:image
https://pitit.eu/assets/img/favicon-512.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19maand13email12gratis11jouw10abonnees
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
maand
email
gratis
jouw
abonnees
Keywords Cloud Test
abonneeabonneesaccountallealleenallesamazonanalyticsandereautomatischebackendbeheerbekijkbetaalbeveiligingbouncebouncesbuildercampagnecampagnesclickclickscompleteconfiguratiecontroledeliverabilitydkimeditoreffectieveeigenemailemailsencryptieexportfeaturesgebruikgedeeldgedetailleerdegeengraadgratisgroepgroepenguidehandlinghebthogeimportinbegrepeninclusiefinloggenintegratiejaarabonnementjouwkoppelingkostenkrachtigelagelimietenmaakmaandmailinglijstmarketingmeermilitairenietnieuwsbrievennodigonbeperktonzeopenopensopgeslagenpersonaliseerpersoonsgegevenspititplanplanningpoweredprachtigeprijzenprivacyprofessionelereputationsendersetupstartstartenstatistiekentracktrackingunsubscribesvariabelenvergelijkversleuteldvolledigevoorvooruitwebhookworden
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Professionele Email Campagnes
H2 tags
Alles wat je nodig hebt
Eenvoudige Prijzen
Vergelijk en bespaar
Jouw data is van jou. Niet van ons.
Waarom jouw eigen AWS SES?
Geen zin om AWS zelf te configureren?
Klaar om te starten?
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 91
Failed: 1
Warnings: 0
Passed: 19
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 6.19 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 402 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 37.99 Kb to 6.19 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.29 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
javascript
48.7 %
169.23 Kb
font
36.9 %
128.04 Kb
css
11.9 %
41.21 Kb
html
1.9 %
6.58 Kb
image
0.7 %
2.39 Kb
other
0.0 %
0 B
TOTAL
100%
347.44 Kb
Requests by content type
Content type
Percent
Requests
css
28.6 %
2
javascript
28.6 %
2
html
14.3 %
1
image
14.3 %
1
font
14.3 %
1
other
0.0 %
0
TOTAL
100%
7
Content size by domain
Domain
Percent
Size
cdn.jsdelivr.net
55.9 %
194.27 Kb
googletagmanager.com
42.2 %
146.59 Kb
pitit.eu
1.9 %
6.58 Kb
TOTAL
100%
347.44 Kb
Requests by domain
Domain
Percent
Requests
cdn.jsdelivr.net
71.4 %
5
pitit.eu
14.3 %
1
googletagmanager.com
14.3 %
1
TOTAL
100%
7
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.220 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.22 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.212 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.212 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.21 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.21 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Professionele Email Campagnes
Html:

Professionele Email Campagnes

Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0012. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0012

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0012
Server and security
Score: 68
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "pitit.eu" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
pitit.eu
Subject Alternative Names (SANs)
*.pitit.eu, pitit.eu
Not valid before
Fri, February 6o 2026, 7:51:07 am (z)
Not valid after
Thu, May 7o 2026, 7:51:06 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R13
Intermediate certificate
Common name
R13
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://pitit.eu/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://pitit.eu" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +a:ww1.ppiitt.nl -all
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=UTF-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved