seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://parketoverstock.be
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
2 Warnings
49 Passed
Common SEO issues
Score: 82
Failed: 3
Warnings: 1
Passed: 20
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Eiken Parket - Eiken Trappen - Stofvrij Parket Schuren
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Zoekt u een kwalitatieve samengestelde parket aan een scherpe prijs? Graag een degelijke uitleg en duidelijke informatie over parket, de afwerking en het onderhoud? Verkoop - Plaatsing - Begeleiding - Renovatie - Onderhoud
Google Search Results Preview Test
Desktop version
https://parketoverstock.beEiken Parket - Eiken Trappen - Stofvrij Parket SchurenZoekt u een kwalitatieve samengestelde parket aan een scherpe prijs? Graag een degelijke uitleg en duidelijke informatie over parket, de afwerking en het onderhoud? Verkoop - Plaatsing - Begeleiding - Renovatie - Onderhoud
Mobile version
https://parketoverstock.beEiken Parket - Eiken Trappen - Stofvrij Parket SchurenZoekt u een kwalitatieve samengestelde parket aan een scherpe prijs? Graag een degelijke uitleg en duidelijke informatie over parket, de afwerking en het onderhoud? Verkoop - Plaatsing - Begeleiding - Renovatie - Onderhoud
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
50parket20eiken12vloerverwarming12trap12voor
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
adviesafgewerktafspraakafsprakenafwerkingallemaalbeidebekledenberlaarbestaandbetaalbarebetonnenbonheidenbreedtesbvbacheckcontactcontacteerdegelijkedezediktesdoendoorechteikeneuropesegedaangeengeoliedgraaggradatiesgrijshebbenhomehongaarsehoutinfoinvisiblekeerbergenkeuskunnenkwalitatieveleuvenlevertlotenmagazijnmakenmannenmechelenmijnmodernemooiernaarnaturelnietnieuwbouwolieonzeoverstockparketparketoverstockparkettenparketvloerenpassieperfectplaatsenplaatsingplaatstplankenvloerenpremiumprimeprobleempuntputterenovatierustieksamengesteldeschurenseansoortspiegelsteedsstockstofvrijtijdtraptrappenvernisverschillendevisgraatvloerverwarmingvoorvoorraadvoorwaardenvragenwerkenzeerzelfzijnzoek
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
PARKET OVERSTOCK
Eiken parket - eiken trappen - stofvrij schuren
H2 tags
Betaalbare samengestelde parketten en eiken trappen!
Wie zijn wij?
Een trap passend bij je nieuw parket?
Stofvrij schuren van je bestaand parket?
Een greep uit ons gamma:
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our newĀ Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator fromĀ SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • All images in this page are properly sized for different users' viewports.
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
FacebookĀ 
Speed optimizations
Score: 91
Failed: 2
Warnings: 1
Passed: 13
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 20.96 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 166.54 Kb to 20.96 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 1.51 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
45.9 %
209.84 Kb
javascript
40.4 %
184.71 Kb
css
9.2 %
42.19 Kb
html
4.5 %
20.80 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
457.54 Kb
Requests by content type
Content type
Percent
Requests
javascript
45.1 %
23
image
45.1 %
23
css
7.8 %
4
html
2.0 %
1
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
51
Content size by domain
Domain
Percent
Size
parketoverstock.be
74.2 %
339.64 Kb
googletagmanager.com
17.7 %
80.81 Kb
google-analytics.com
4.4 %
19.92 Kb
googleadservices.com
3.3 %
15.03 Kb
googleads.g.doubleclick.net
0.4 %
1.60 Kb
google.com
0.1 %
548 B
TOTAL
100%
457.54 Kb
Requests by domain
Domain
Percent
Requests
parketoverstock.be
88.2 %
45
googletagmanager.com
3.9 %
2
google-analytics.com
2.0 %
1
googleadservices.com
2.0 %
1
googleads.g.doubleclick.net
2.0 %
1
google.com
2.0 %
1
TOTAL
100%
51
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 78
Failed: 2
Warnings: 0
Passed: 6
URL Canonicalization Test
SSL Checker and HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "parketoverstock.be" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.parketoverstock.be
Subject Alternative Names (SANs)
*.parketoverstock.be, parketoverstock.be
Not valid before
Sat, February 5o 2022, 7:41:32 pm (z)
Not valid after
Fri, May 6o 2022, 7:41:31 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=1790" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 52
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://parketoverstock.be is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://parketoverstock.be" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved