seo site checkup logo
PricingFree ToolsArticles
Report generated 8 months ago
https://osis.praditadirgantara.sch.id
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
3 Warnings
63 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
Common SEO issues
Score: 70
Failed: 4
Warnings: 1
Passed: 21
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Beranda | OSIS SMA Pradita Dirgantara
Length: 37 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://osis.praditadirgantara.sch.id/Beranda | OSIS SMA Pradita Dirgantara
Mobile version
https://osis.praditadirgantara.sch.id/Beranda | OSIS SMA Pradita Dirgantara
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Beranda | OSIS SMA Pradita Dirgantara
og:description
OSIS SMA Pradita Dirgantara Untuk Siswa, Kita Bahagia! About Us What We Do Kami Berinovasi Inovasi adalah kekuatan kami. Kami terus mencari ide-ide segar, mengumpulkan solusi kreatif, dan mendorong budaya berpikir maju, serta terus beradaptasi dan berkembang untuk memenuhi kebutuhan siswa yang terus berubah. Melalui komitmen kami dalam berinovasi, kami berusaha untuk menghadirkan inisiatif-inisiatif yang […]
og:url
https://osis.praditadirgantara.sch.id/
og:site_name
OSIS SMA Pradita Dirgantara
og:image
http://osis.praditadirgantara.sch.id/wp-content/uploads/2023/11/OSIS.png
og:image:width
900
og:image:height
899
og:image:type
image/png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
13kami10yang8untuk7pradita5siswa
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
kami
yang
untuk
pradita
siswa
Keywords Cloud Test
adalahadikbagaikanbahagiabahwabakatberadaptasiberandaberartiberbagaiberinovasiberkembangberkolaborasiberpikirbersamaberubahberusahablogpostbudayacheckcontactcontentdalamdaridengandibagikandidengardihargaidirgantaraefektifekskulfeaturedfebruaryhanyainisiatifinklusifinovasijadijanuaryjugakakakkamikarjakebijakankebutuhankekuatankerjakitakolaborasikomitmenkreatifkuncilingkunganmajumelaluimemanfaatkanmembinamembukamemenuhimemoirmemperbaruimenarikmencarimenciptakanmendorongmenerapkanmengatasimengedepankanmenghadirkanmengumpulkanmenuosispencapaianpengalamanpercayaperspektifpertumbuhanperubahanpraditaprofilprogramsamasebuahsecarasegarseharisekolahsertasinergisiswaskipsolusisuaratantanganterustetapithamrintujuanuntukyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Pradita dan M.H. Thamrin, Bagaikan Adik dan Kakak
Beyond The Books: Liburan Ala Pradita!
Sehari Jadi Siswa Pradita!
Hari Pahlawan – Horay Party!
H2 tags
OSIS SMA Pradita Dirgantara
What We Do
Featured Posts
Featured Programs
Follow Our Socials
Komplek Bandara Adi Soemarmo Solo, Jl. Cendrawasih No.4, Tanjungsari, Ngesrep, Kec. Ngemplak, Kabupaten Boyolali, Jawa Tengah 57375 © 2023 OSIS SMA Pradita Dirgantara
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 92
Failed: 1
Warnings: 1
Passed: 23
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 19.62 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 383 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 108.08 Kb to 19.62 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.7 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
69.9 %
1.16 Mb
font
13.7 %
232.66 Kb
javascript
7.0 %
118.42 Kb
css
6.0 %
102.59 Kb
html
3.4 %
57.12 Kb
other
0.0 %
0 B
TOTAL
100%
1.66 Mb
Requests by content type
Content type
Percent
Requests
image
35.0 %
7
font
30.0 %
6
html
15.0 %
3
css
10.0 %
2
javascript
10.0 %
2
other
0.0 %
0
TOTAL
100%
20
Content size by domain
Domain
Percent
Size
osis.praditadirgantara.sch.id
87.5 %
1.45 Mb
fonts.gstatic.com
7.2 %
122.80 Kb
googletagmanager.com
5.3 %
89.40 Kb
TOTAL
100%
1.66 Mb
Requests by domain
Domain
Percent
Requests
osis.praditadirgantara.sch.id
75.0 %
15
fonts.gstatic.com
20.0 %
4
googletagmanager.com
5.0 %
1
TOTAL
100%
20
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.305 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.305 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.893 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.893 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.76 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.76 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: OSIS SMA Pradita Dirgantara Untuk Siswa, Kita Bahagia! About Us
Html: <div class="elementor-element elementor-element-e3ad52b e-flex..." data-id="e3ad52b" data-element_type="container" data-settings="{"background_background":"classic"}">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0002. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0002

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0002
Server and security
Score: 76
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "osis.praditadirgantara.sch.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.praditadirgantara.sch.id
Subject Alternative Names (SANs)
*.praditadirgantara.sch.id, praditadirgantara.sch.id
Not valid before
Fri, September 22o 2023, 1:32:02 am (z)
Not valid after
Tue, October 22o 2024, 6:37:25 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
AlphaSSL CA - SHA256 - G4
Intermediate certificate
Common name
AlphaSSL CA - SHA256 - G4
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, October 12o 2022, 3:49:43 am (z)
Not valid after
Tue, October 12o 2027, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign Root CA
Root certificate
Common name
GlobalSign Root CA
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Tue, September 1o 1998, 12:00:00 pm (z)
Not valid after
Fri, January 28o 2028, 12:00:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
GlobalSign Root CA
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://osis.praditadirgantara.sch.id/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://osis.praditadirgantara.sch.id/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved