seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://opnco.net/cms
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 69 out of 100, which is below the average score of 74. However, there are 16 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
16 Failed
8 Warnings
50 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 67
Failed: 7
Warnings: 2
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: OPNCO Marine Supply and Repair services
Length: 39 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 273 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Expert in marine engineering and mechanical installations since 1988, providing comprehensive ship maintenance, fuel systems, and cargo handling solutions for various vessels, including superyachts and offshore support ships. Sustainable and future-proof maritime services.
Length: 273 characters
Google Search Results Preview Test
Desktop version
https://opnco.net/cms/OPNCO Marine Supply and Repair servicesExpert in marine engineering and mechanical installations since 1988, providing comprehensive ship maintenance, fuel systems, and cargo handling solutions for various vessels, including superyachts and offshore support ships. Sustainable and future-proof maritime services.
Mobile version
https://opnco.net/cms/OPNCO Marine Supply and Repair servicesExpert in marine engineering and mechanical installations since 1988, providing comprehensive ship maintenance, fuel systems, and cargo handling solutions for various vessels, including superyachts and offshore support ships. Sustainable and future-proof maritime services.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
38services27repair22marine19opnco17safety
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
services
repair
marine
opnco
safety
Keywords Cloud Test
auxiliaryblogcalibrationchallengecleaningclearclientscommitmentcompliancecomponentscomprehensiveconsultationscontactcriticaldaihatsudedicatedefficiencyeffortselectricalemergencyemissionsengineenginesensureensuringenvironmentalequipmentexcellenceexperiencedexpertexpertisefeaturingfocusfuelhullincreasingindustryinfoinspectionlatestlistmaintenancemanufacturersmarinemaritimemeetmissionnavigatingneedsnewsofferoperationsopncooptimalpartsperformancepreciseprecisionprioritizeprojectprovidequalityreadreadyreductionregardingreliablerepairrepairsrestoringsafetysailingscrutinyserviceservicesshanghaishipshipyardskilledsmoothsparespecializespecificstandardssulzersupplysupportsystemstailoredtankteamtermsthoroughunparalleledusedvariousvesselvoyagewartsilayanmar
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Navigating Excellence in Marine Supply and Repair services
Your vessel Is our Commitment
H2 tags
PROFESSIONAL SHIP SERVICES FOR RELIABLE OPERATIONS
WHY CHOOSE OPNCO Marine Supply and Repair services
SPECIAL FEATURES OPNCO Marine Supply and Repair services
OPNCO SERVICES
178
142
147
14
BOOKING FORM Marine Supply and Repair services
FREEQUENTLY ASKED QUESTIONS
LATEST NEWS
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Pinterest 
Speed optimizations
Score: 70
Failed: 4
Warnings: 5
Passed: 16
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 14.35 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 898 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 97.93 Kb to 14.35 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 9.36 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
84.9 %
3.56 Mb
javascript
9.2 %
396.82 Kb
font
4.0 %
169.78 Kb
css
1.5 %
65.74 Kb
html
0.3 %
12.65 Kb
other
0.0 %
1.53 Kb
TOTAL
100%
4.19 Mb
Requests by content type
Content type
Percent
Requests
image
44.9 %
35
javascript
30.8 %
24
css
15.4 %
12
html
3.8 %
3
font
3.8 %
3
other
1.3 %
1
TOTAL
100%
78
Content size by domain
Domain
Percent
Size
opnco.net
91.9 %
3.86 Mb
embed.tawk.to
4.1 %
174.11 Kb
fonts.gstatic.com
2.2 %
94.27 Kb
connect.facebook.net
1.8 %
75.27 Kb
va.tawk.to
0.0 %
1.53 Kb
fonts.googleapis.com
0.0 %
1.33 Kb
TOTAL
100%
4.19 Mb
Requests by domain
Domain
Percent
Requests
opnco.net
82.1 %
64
embed.tawk.to
10.3 %
8
connect.facebook.net
2.6 %
2
fonts.gstatic.com
2.6 %
2
fonts.googleapis.com
1.3 %
1
va.tawk.to
1.3 %
1
TOTAL
100%
78
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.227 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.227 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.653 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.653 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.04 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.04 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: NAVIGATING EXCELLENCE IN MARINE SUPPLY AND REPAIR SERVICES At OPNCO, we special...
Html: <div class="slider-item flex" style="background-image:url(https://opnco.net/cms/public/...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.1216. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1216

0.1

0.25

Server and security
Score: 76
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "opnco.net" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.opnco.ir
Subject Alternative Names (SANs)
*.opnco.ir, *.opnco.net, opnco.ir, opnco.net
Not valid before
Wed, October 30o 2024, 11:26:01 am (z)
Not valid after
Tue, January 28o 2025, 11:26:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 37
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +mx +a +ip4:185.94.99.237 +ip4:89.42.209.235 ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved