seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://online-fix.me/page/12
Your general SEO Checkup Score
Archived
61/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 61 out of 100, which is below the average score of 75. However, there are 22 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
22 Failed
3 Warnings
49 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 47
Failed: 9
Warnings: 2
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Online-Fix » Страница 12
Length: 24 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 141 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Помощь с запуском сетевых игр онлайн. Фиксы, как правильно подключаться, создавать сервер, создавать игру через локальную сеть. » Страница 12
Length: 141 characters
Google Search Results Preview Test
Desktop version
https://online-fix.me/page/12/Online-Fix » Страница 12Помощь с запуском сетевых игр онлайн. Фиксы, как правильно подключаться, создавать сервер, создавать игру через локальную сеть. » Страница 12
Mobile version
https://online-fix.me/page/12/Online-Fix » Страница 12Помощь с запуском сетевых игр онлайн. Фиксы, как правильно подключаться, создавать сервер, создавать игру через локальную сеть. » Страница 12
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Online-Fix » Страница 12
og:type
website
og:description
Помощь с запуском сетевых игр онлайн. Фиксы, как правильно подключаться, создавать сервер, создавать игру через локальную сеть.
og:url
https://online-fix.me/
og:image
https://online-fix.me/uploads/logo.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
77сети31июня26игра26steam22через
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
сети
июня
игра
steam
через
Keywords Cloud Test
abioticadblockbuildchainclashcurseddayzdayzavrdicedirectorsemberepicexomeexorcismfactorfarmfoundrygamegamesgatekeepergearghostgroundedguiltyjianghujujutsukaisenkingdomsknightsmassacreonlinepagoniapanicorepartypaydaypioneerspoweredpummelpuzzlerabbitrisingsalesimulatorsoulmaskspankystardewsteamsteelstorestrivesurvivortexastranslatetsushimavalleywizardsworksаккаунтбраузеребудетверсиивключенвниманиевопросамвходвызыватьданныйдобавлензабылиграигруигрыиюляиюнякооперативможетемультиплееробновленаобновленияобновленообращатьсяотключитепарольподдержитепопулярноепочтупроблемыпроектрегистрациярежимырелизсайтасегоднясетискриптсновасоцсетистороннийфункционаломчерез
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Jianghu Survivor по сети
EXOME по сети
Puzzle Compound по сети
Bread and Fred по сети
My Garage по сети
Life Not Supported по сети
Heist Kitty Multiplayer Cat Simulator Game по сети
Its Only Money по сети
Mars First Logistics по сети
Worms Clan Wars по сети
Six Days in Fallujah по сети
Modbox по сети
Ice Lakes по сети
Mechabellum по сети
Unboxing the Cryptic Killer по сети
Zedfest по сети
Beyond Contact по сети
Inout по сети
ICARUS по сети
The RPG Engine по сети
Glitch Busters Stuck On You по сети
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
1center
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=windows-1251
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 67
Failed: 7
Warnings: 1
Passed: 17
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 27.82 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,683 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 141.32 Kb to 27.82 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 10.6 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
50.2 %
1.39 Mb
javascript
40.5 %
1.13 Mb
font
5.1 %
144.05 Kb
css
3.2 %
90.60 Kb
other
0.6 %
16.13 Kb
html
0.6 %
15.68 Kb
TOTAL
100%
2.78 Mb
Requests by content type
Content type
Percent
Requests
other
34.8 %
62
image
30.3 %
54
javascript
28.1 %
50
css
3.9 %
7
font
2.2 %
4
html
0.6 %
1
TOTAL
100%
178
Content size by domain
Domain
Percent
Size
online-fix.me
60.5 %
1.68 Mb
yastatic.net
6.8 %
193.19 Kb
tube.buzzoola.com
5.8 %
164.15 Kb
imasdk.googleapis.com
5.5 %
157.92 Kb
yandex.ru
3.7 %
104.22 Kb
mc.yandex.ru
2.5 %
72.04 Kb
translate.googleapis.com
2.5 %
71.83 Kb
cdnjs.cloudflare.com
2.4 %
68.14 Kb
videoroll.net
2.1 %
60.94 Kb
cdn.adplay.ru
1.4 %
39.91 Kb
Other
6.8 %
192.23 Kb
TOTAL
100%
2.78 Mb
Requests by domain
Domain
Percent
Requests
online-fix.me
37.6 %
67
logs.adplay.ru
15.7 %
28
yandex.ru
14.6 %
26
tube.buzzoola.com
5.1 %
9
mc.yandex.com
3.4 %
6
yastatic.net
3.4 %
6
ippeachcod.com
2.2 %
4
gstatic.com
1.7 %
3
counter.yadro.ru
1.1 %
2
videoroll.net
1.1 %
2
Other
14.0 %
25
TOTAL
100%
178
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.153 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.153 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.886 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.886 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.55 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.55 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="header-pic" style="background-color: #00070f; background-image: url('...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0040. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.004

0.1

0.25

DOM element which contributes the most to CLS score:
Text: У Вас (2) сообщения Приветик, сделаешь мне приятно? ❤️ 7:0 Закрыть Перейти Подр...
Html: <div id="qwerty_wrap" class="no-pop" style="width: 380px; min-height: 90px; font-family: "Open...">
Score: 0.0025
Server and security
Score: 76
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "online-fix.me" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
online-fix.me
Subject Alternative Names (SANs)
*.online-fix.me, online-fix.me
Not valid before
Wed, May 29o 2024, 1:56:51 pm (z)
Not valid after
Tue, August 27o 2024, 1:56:50 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
E1
Intermediate certificate
Common name
E1
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Root certificate
Common name
ISRG Root X2
Organization
Internet Security Research Group
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 17o 2040, 4:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 35
Failed: 4
Warnings: 0
Passed: 6
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:31.172.70.102 -all
Ads.txt Validation Test68% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but its content has invalid records! Having errors in this file would cause advertisers to not recognize and ignore the authorized sellers list and that will lead to lost revenue.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved