seo site checkup logo
PricingFree ToolsArticles
Report generated 4 months ago
https://nomady.camp/en-us
Your general SEO Checkup Score
Archived
73/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 73 out of 100, which is below the average score of 75. However, there are 16 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
16 Failed
4 Warnings
54 Passed
Issues to fix
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
While a canonical link tag can help in resolving duplicate content issues, it's important to verify that the specified URL is accurate, especially if the site's URL structure has been recently updated.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 65
Failed: 6
Warnings: 2
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Nomady - close to nature campsites and shelters
Length: 47 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 125 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: The most beautiful campsites and cozy cabins with private hosts. Perfect for your next camping adventure. Book easily online.
Length: 125 characters
Google Search Results Preview Test
Desktop version
https://nomady.camp/en-usNomady - close to nature campsites and sheltersThe most beautiful campsites and cozy cabins with private hosts. Perfect for your next camping adventure. Book easily online.
Mobile version
https://nomady.camp/en-usNomady - close to nature campsites and sheltersThe most beautiful campsites and cozy cabins with private hosts. Perfect for your next camping adventure. Book easily online.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:description
The most beautiful campsites and cozy cabins with private hosts. Perfect for your next camping adventure. Book easily online.
og:title
Nomady - close to nature campsites and shelters
og:type
website
og:url
https://nomady.camp/en-US
og:locale
en-US
og:image
https://static.nomady.camp/cms/medium_230205_Nomady_Web_Fruehling_Sommer23_B_a510d03314.webp
og:image:width
750
og:image:height
500
og:site_name
Nomady
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
61camping54nature27nomady24experience22trips
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
camping
nature
nomady
experience
trips
Keywords Cloud Test
accommodationaccommodationsadventureadventuresauthenticawaybookingcampcampercamperscampingcampscampsitecardchoicecloseclosercountrycreateculturediscoverearnefficientenjoyenvironmentallyexperienceexperiencesfamilyfarmforestformfreegentlegenuinegermanygiftglampinghavehavinghiddenhikinghomehospitalityhosthostshotspotsidealidyllicinspireditalyknowlakelandlandscapeslargelifelittlelocallonglookingmassmemoriesmicroadventuremoneynaturenearbynomadyofferoffersopportunitypeopleperfectplacespossibleprivaterealregionregionsremoteruralscarcesimplesitessmallspotsstayswitzerlandtenttimetourismtraveltreasurestriptripsunforgettableuniquevaluevicinitywantwild
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Find your place in nature
H2 tags
A gift card to simply be outside.
Your next camping adventure
A campsite all to yourself!
Get inspired!
How it works
Download the Nomady app now for free
Subscribe to our newsletter and stay updated on the latest camps, news and inspirations.
Hosting
Our partners
Nomady - Everything you need to know.
Campsites for your tent, bus, camper or caravan in...
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 65
Failed: 8
Warnings: 1
Passed: 16
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,442 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 482.18 Kb to 88.73 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 11.24 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
67.5 %
2.21 Mb
image
24.8 %
832.57 Kb
other
4.3 %
144.80 Kb
html
2.6 %
88.28 Kb
css
0.8 %
25.27 Kb
font
0.0 %
0 B
TOTAL
100%
3.28 Mb
Requests by content type
Content type
Percent
Requests
javascript
38.6 %
22
image
28.1 %
16
other
26.3 %
15
html
3.5 %
2
css
3.5 %
2
font
0.0 %
0
TOTAL
100%
57
Content size by domain
Domain
Percent
Size
nomady.camp
57.6 %
1.89 Mb
static.nomady.camp
14.9 %
498.82 Kb
googletagmanager.com
11.8 %
395.15 Kb
app.usercentrics.eu
5.6 %
187.40 Kb
js.stripe.com
5.1 %
169.56 Kb
analytics.tiktok.com
4.2 %
141.90 Kb
cms.nomady.camp
0.5 %
15.17 Kb
api.usercentrics.eu
0.3 %
10.46 Kb
static.nomady.ch
0.1 %
3.40 Kb
uct.service.usercentrics.eu
0.0 %
253 B
Other
0.0 %
87 B
TOTAL
100%
3.28 Mb
Requests by domain
Domain
Percent
Requests
nomady.camp
33.3 %
19
app.usercentrics.eu
24.6 %
14
static.nomady.camp
12.3 %
7
analytics.tiktok.com
8.8 %
5
googletagmanager.com
5.3 %
3
api.usercentrics.eu
5.3 %
3
cms.nomady.camp
3.5 %
2
js.stripe.com
1.8 %
1
consent-api.service.consent.usercentrics.eu
1.8 %
1
uct.service.usercentrics.eu
1.8 %
1
Other
1.8 %
1
TOTAL
100%
57
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.374 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.374 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.159 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.159 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.25 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.25 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Become a host Choose dates Vehicles & Guests Filters Find your place in nature D...
Html: <section class="sc-17epcj7-0 dbYwnX">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0443. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0443

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Your next camping adventure Available at the weekend Accommodation in the vicini...
Html: <div class="r2k0lk-2 jcsZuv">
Score: 0.0343
Server and security
Score: 93
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "nomady.camp" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
nomady.camp
Subject Alternative Names (SANs)
nomady.camp, www.nomady.camp
Not valid before
Sun, November 10o 2024, 12:00:00 am (z)
Not valid after
Wed, December 10o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon RSA 2048 M03
Intermediate certificate
Common name
Amazon RSA 2048 M03
Organization
Amazon
Location
US
Not valid before
Tue, August 23o 2022, 10:26:04 pm (z)
Not valid after
Fri, August 23o 2030, 10:26:04 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=15552000; includesubdomains
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 87
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://nomady.camp/en-US should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link data-rh="true" href="https://nomady.camp/en-US" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 a mx include:servers.mcsv.net include:_spf.google.com include:amazonses.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved