seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://netvalidity.com
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 87 out of 100, which is higher than the average score of 75. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
6 Warnings
52 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 74
Failed: 3
Warnings: 2
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 18 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Home - NetValidity
Length: 18 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Professional IT consulting in Dubai. Netvalidity offers expert IT solutions, cybersecurity, and digital transformation services for businesses in the UAE.
Length: 154 characters
Google Search Results Preview Test
Desktop version
https://netvalidity.com/Home - NetValidityProfessional IT consulting in Dubai. Netvalidity offers expert IT solutions, cybersecurity, and digital transformation services for businesses in the UAE.
Mobile version
https://netvalidity.com/Home - NetValidityProfessional IT consulting in Dubai. Netvalidity offers expert IT solutions, cybersecurity, and digital transformation services for businesses in the UAE.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Home - NetValidity
og:description
Professional IT consulting in Dubai. Netvalidity offers expert IT solutions, cybersecurity, and digital transformation services for businesses in the UAE.
og:url
https://netvalidity.com/
og:site_name
NetValidity
og:image
https://netvalidity.com/wp-content/uploads/2025/07/cybersec-image-1-e1753877611811.jpeg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11cookies10services7cybersecurity6performance6network
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
cookies
services
cybersecurity
performance
network
Keywords Cloud Test
acceptactiveadjustingadvertisementanalyseanalyticalanalyticsbasedbasicbelieveblogbrowserbuildbuildingbusinesscategorisedcategorycertaincollectcollectingcomputerconsentconsultancyconsultingcontactcontentcontinuingcookiescustomisecybersecuritydefensesdesigndetaileddigitaldubaiefficientlyenableenablingessentialexpertezabookfeaturesfeedbackfunctionalfunctionalitiesfunctionsgooglehelphomeidentifiableifzaimproveinformationinfrastructureinteractlearnlikelongmakemediametricsnavigatenecessarynetvaliditynetworkpagesparkpartyperformperformancepersonallyplatformspreferencesprovideprovidingrealrecoveryreliablerequiredresultssecuresecurityservicessharingsitesocialsolutionsstatisticalstorestoredsystemstechnologytermtrustunderstandusedvisitorswebsitewirelesswork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Expert IT Consulting. Real Results.
H2 tags
IT Consultancy UAE – Reliable. Secure. Built for Growth.
What We Believe​
Building A1, IFZA business park, Dubai, UAE
Pages
Useful Links
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 62
Failed: 7
Warnings: 3
Passed: 10
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 478 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 273.31 Kb to 34.19 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.11 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
69.8 %
569.71 Kb
javascript
20.2 %
165.33 Kb
css
5.9 %
48.28 Kb
html
4.1 %
33.36 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
816.68 Kb
Requests by content type
Content type
Percent
Requests
css
46.2 %
12
javascript
26.9 %
7
image
23.1 %
6
html
3.8 %
1
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
26
Content size by domain
Domain
Percent
Size
netvalidity.com
83.3 %
680.34 Kb
googletagmanager.com
16.6 %
135.40 Kb
fonts.googleapis.com
0.1 %
959 B
TOTAL
100%
816.68 Kb
Requests by domain
Domain
Percent
Requests
netvalidity.com
92.3 %
24
fonts.googleapis.com
3.8 %
1
googletagmanager.com
3.8 %
1
TOTAL
100%
26
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
See results list
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.902 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.902 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.001 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.001 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.35 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.35 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: From infrastructure to cybersecurity – we make technology work for you. Expert ...
Html: <div class="kb-row-layout-wrap kb-row-layout-id988_be36fe-af a...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 59
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "netvalidity.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
netvalidity.com
Subject Alternative Names (SANs)
*.netvalidity.com, netvalidity.com
Not valid before
Wed, July 2o 2025, 5:26:53 am (z)
Not valid after
Tue, September 30o 2025, 5:26:52 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
E6
Intermediate certificate
Common name
E6
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, minimum-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://netvalidity.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://netvalidity.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:zohomail.eu ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved