seo site checkup logo
PricingFree ToolsArticles
Report generated 3 hours ago
https://navbharatlive.com/sports/cricket/sunil-gavaskar-defends-gautam-gambhir-after-india-loses-test-series-to-south-africa-1438933.html
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 16 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
16 Failed
3 Warnings
42 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 69
Failed: 4
Warnings: 1
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 104 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: कोच सिर्फ टीम तैयार कर सकता है…गौतम गंभीर पर भड़के लोगों की सुनील गावस्कर ने लगाई क्लास | Navbharat Live
Length: 104 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Sunil Gavaskar: साउथ अफ्रीका ने भारत को 2-0 से हराया। भारतीय बल्लेबाज फेल रहे। सुनील गावस्कर ने हेड कोच गौतम गंभीर का बचाव किया और हार का दोष सिर्फ उन्हें देने को गलत बताया।
Length: 174 characters
Google Search Results Preview Test
Desktop version
https://navbharatlive.com/sports/cricket/sunil-gavaskar-defends-gautam-gambhir-after-india-loses-test-series-to-south-africa-1438933.htmlकोच सिर्फ टीम तैयार कर सकता है…गौतम गंभीर पर भड़के लोगों की सुनील गावस्कर ने लगाई क्लास | Navbharat LiveSunil Gavaskar: साउथ अफ्रीका ने भारत को 2-0 से हराया। भारतीय बल्लेबाज फेल रहे। सुनील गावस्कर ने हेड कोच गौतम गंभीर का बचाव किया और हार का दोष सिर्फ उन्हें देने को गलत बताया।
Mobile version
https://navbharatlive.com/sports/cricket/sunil-gavaskar-defends-gautam-gambhir-after-india-loses-test-series-to-south-africa-1438933.htmlकोच सिर्फ टीम तैयार कर सकता है…गौतम गंभीर पर भड़के लोगों की सुनील गावस्कर ने लगाई क्लास | Navbharat LiveSunil Gavaskar: साउथ अफ्रीका ने भारत को 2-0 से हराया। भारतीय बल्लेबाज फेल रहे। सुनील गावस्कर ने हेड कोच गौतम गंभीर का बचाव किया और हार का दोष सिर्फ उन्हें देने को गलत बताया।
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Navbharat Live
og:locale
hi_IN
og:logo
https://d1xx0c244jch9c.cloudfront.net/wp-content/uploads/2025/06/NB-new-logo.svg
og:type
article
og:title
कोच सिर्फ टीम तैयार कर सकता है…गौतम गंभीर पर भड़के लोगों की सुनील गावस्कर ने लगाई क्लास | Navbharat Live
og:description
Sunil Gavaskar: साउथ अफ्रीका ने भारत को 2-0 से हराया। भारतीय बल्लेबाज फेल रहे। सुनील गावस्कर ने हेड कोच गौतम गंभीर का बचाव किया और हार का दोष सिर्फ उन्हें देने को गलत बताया।
og:url
https://navbharatlive.com/sports/cricket/sunil-gavaskar-defends-gautam-gambhir-after-india-loses-test-series-to-south-africa-1438933.html
og:image
https://d1xx0c244jch9c.cloudfront.net/wp-content/uploads/2025/11/Sunil-Gavaskar-and-Gautam-Gambhir.jpg
og:image:width
1280
og:image:height
720
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
24navbharat24live20undo12sponsored9news
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
navbharat
live
undo
sponsored
news
Keywords Cloud Test
affordableafricaarunachalauthorautoayodhyabedsblosbusinesscampercareercitiescomfortconditionsconfidentlycontactcopyrightcricketdefendsdentaldisclaimerdiscoverelectionentertainmentepaperexplorefollowgambhirgautamgavaskargroupsharyanahindiignoredimplantimplantsindiaindianinstantlyknowlatestlearnlikelinkslivelosesmadhyamaharashtramandirmarathimodinavbharatnavbharatlivenewsoptionspolicypopularpradeshprivacypromotedpublishedratesreligionreservedrightssearchsearchessearchtopicssectionseniorseniorsseriessitemapsleepsmilesouthsponsoredsportsstatessuniltaboolateamtechtermstesttopicstraveltrendinganswerstrendsundoupdateupdatedupgradevansvideoworldअगहनअसफलएयरपकटघर
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
कोच सिर्फ टीम तैयार कर सकता है…गौतम गंभीर पर भड़के लोगों की सुनील गावस्कर ने लगाई क्लास
H2 tags
Sunil Gavaskar: साउथ अफ्रीका ने भारत को 2-0 से हराया। भारतीय बल्लेबाज फेल रहे। सुनील गावस्कर ने हेड कोच गौतम गंभीर का बचाव किया और हार का दोष सिर्फ उन्हें देने को गलत बताया।
सम्बंधित ख़बरें
लेटेस्ट न्यूज़
वीडियो गैलरी
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 60
Failed: 7
Warnings: 2
Passed: 11
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,536 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 478.7 Kb to 92.19 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.94 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
71.0 %
2.30 Mb
image
21.6 %
716.60 Kb
font
4.0 %
132.65 Kb
html
1.4 %
45.35 Kb
other
1.4 %
44.88 Kb
css
0.6 %
20.90 Kb
TOTAL
100%
3.24 Mb
Requests by content type
Content type
Percent
Requests
image
50.0 %
60
javascript
25.8 %
31
other
13.3 %
16
html
7.5 %
9
css
1.7 %
2
font
1.7 %
2
TOTAL
100%
120
Content size by domain
Domain
Percent
Size
googletagmanager.com
28.2 %
933.85 Kb
a.vdo.ai
14.8 %
490.05 Kb
images.taboola.com
10.2 %
339.31 Kb
cdn.taboola.com
9.1 %
302.46 Kb
d1xx0c244jch9c.cloudfront.net
7.7 %
254.77 Kb
securepubads.g.doubleclick.net
7.5 %
249.06 Kb
imasdk.googleapis.com
4.3 %
142.53 Kb
fonts.gstatic.com
4.0 %
132.65 Kb
navbharatlive.com
3.7 %
122.52 Kb
images.navbharatlive.com
3.6 %
119.86 Kb
Other
6.9 %
229.96 Kb
TOTAL
100%
3.24 Mb
Requests by domain
Domain
Percent
Requests
images.taboola.com
19.2 %
23
d1xx0c244jch9c.cloudfront.net
18.3 %
22
images.navbharatlive.com
7.5 %
9
navbharatlive.com
5.8 %
7
googletagmanager.com
5.8 %
7
securepubads.g.doubleclick.net
3.3 %
4
a.vdo.ai
3.3 %
4
analytics.vdo.ai
3.3 %
4
cdn.izooto.com
2.5 %
3
cdn.taboola.com
2.5 %
3
Other
28.3 %
34
TOTAL
100%
120
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.123 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.123 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.668 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.668 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.16 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.16 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img width="1280" height="720" class="lozad" loading="lazy" decoding="async" src="https://images.navbharatlive.com/wp-content/upload..." data-src="https://d1xx0c244jch9c.cloudfront.net/wp-content/u..." alt="कोच सिर्फ टीम तैयार कर सकता है...गौतम गंभीर पर भड़..." title="Sunil Gavaskar and Gautam Gambhir" data-loaded="true">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0391. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0391

0.1

0.25

DOM element which contributes the most to CLS score:
Text: सुनील गावस्कर और गौतम गंभीर (फोटो- सोशल मीडिया)
Html: <div class="article-img">
Score: 0.0389
Server and security
Score: 89
Failed: 1
Warnings: 0
Passed: 6
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "navbharatlive.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
navbharatlive.com
Subject Alternative Names (SANs)
navbharatlive.com, www.navbharatlive.com
Not valid before
Thu, April 24o 2025, 12:00:00 am (z)
Not valid after
Sun, May 24o 2026, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon RSA 2048 M02
Intermediate certificate
Common name
Amazon RSA 2048 M02
Organization
Amazon
Location
US
Not valid before
Tue, August 23o 2022, 10:25:30 pm (z)
Not valid after
Fri, August 23o 2030, 10:25:30 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Root certificate
Common name
Amazon Root CA 1
Organization
Amazon
Location
US
Not valid before
Tue, May 26o 2015, 12:00:00 am (z)
Not valid after
Sun, January 17o 2038, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Amazon Root CA 1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 57
Failed: 4
Warnings: 0
Passed: 5
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
<link href="https://navbharatlive.com/sports/cricket/sunil-gavaskar-defends-gautam-gambhir-after-india-loses-test-series-to-south-africa-1438933.html" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but its content has invalid records! Having errors in this file would cause advertisers to not recognize and ignore the authorized sellers list and that will lead to lost revenue.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved