seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://mytvbd.tv
Your general SEO Checkup Score
Archived
60/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 60 out of 100, which is below the average score of 75. However, there are 22 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
22 Failed
3 Warnings
45 Passed
Issues to fix
HIGH
To provide a good user experience, sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 57
Failed: 8
Warnings: 1
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: MyTv | MyTv Online News
Length: 23 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://mytvbd.tv/MyTv | MyTv Online News
Mobile version
https://mytvbd.tv/MyTv | MyTv Online News
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
3home3career3opportunity3mytv3news
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
home
career
opportunity
mytv
news
Keywords Cloud Test
addressadminaprilbangladeshbhabancareerconditionscontactcopyrightdhakadisclaimereastemailfacebookhatirjheelhomeinternationallivemytvmytvbdnewsopportunitypolicyprivacysearchtermsulonyoutubeউপলকউৎকণএকজনএমনকএসএফবছরওবনচররহমত
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 52
Failed: 8
Warnings: 2
Passed: 13
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 9,072 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 785.22 Kb to 197.52 Kb (75% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.25 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
other
45.2 %
3.81 Mb
javascript
24.2 %
2.05 Mb
image
19.6 %
1.65 Mb
html
6.0 %
517.63 Kb
font
3.5 %
299.00 Kb
css
1.6 %
135.40 Kb
TOTAL
100%
8.44 Mb
Requests by content type
Content type
Percent
Requests
image
31.3 %
77
javascript
21.1 %
52
other
20.3 %
50
html
15.0 %
37
css
6.1 %
15
font
6.1 %
15
TOTAL
100%
246
Content size by domain
Domain
Percent
Size
us170.jagobd.com:444
42.9 %
3.62 Mb
mytvbd.tv
19.4 %
1.64 Mb
youtube.com
12.2 %
1.03 Mb
mcaster.tv
5.0 %
428.60 Kb
pagead2.googlesyndication.com
3.1 %
265.84 Kb
i.ytimg.com
2.7 %
233.84 Kb
googleads.g.doubleclick.net
2.6 %
221.31 Kb
tpc.googlesyndication.com
2.3 %
195.67 Kb
googletagmanager.com
2.2 %
193.93 Kb
jnn-pa.googleapis.com
2.1 %
181.67 Kb
Other
5.5 %
476.48 Kb
TOTAL
100%
8.44 Mb
Requests by domain
Domain
Percent
Requests
mytvbd.tv
22.8 %
56
youtube.com
13.0 %
32
googleads.g.doubleclick.net
8.1 %
20
cm.g.doubleclick.net
7.7 %
19
pagead2.googlesyndication.com
5.3 %
13
jnn-pa.googleapis.com
4.9 %
12
tpc.googlesyndication.com
4.9 %
12
us170.jagobd.com:444
3.3 %
8
mcaster.tv
2.4 %
6
fonts.gstatic.com
2.4 %
6
Other
25.2 %
62
TOTAL
100%
246
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 10.3 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

10.3 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<span class="entry-thumb td-thumb-css td-animation-stack-type0-..." data-type="css_image" data-img-url="https://mytvbd.tv/wp-content/uploads/2023/04/বাস-ও..." style="background-image: url("https://mytvbd.tv/wp-conten...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.13. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.1295

0.1

0.25

DOM element which contributes the most to CLS score:
Text: রামুতে ট্রাক ও অটোরিকশার সংঘর্ষে তিনজন নিহত, আহত ৩ সারাদেশ নাইক্ষ্যংছড়ি উপজেলা...
Html: <div class="vc_row tdi_92 wpb_row td-pb-row">
Score: 0.0796
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "mytvbd.tv" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
mytvbd.tv
Subject Alternative Names (SANs)
mytvbd.tv, www.mytvbd.tv
Not valid before
Sat, April 1o 2023, 12:00:00 am (z)
Not valid after
Tue, April 16o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 31
Failed: 4
Warnings: 0
Passed: 5
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://mytvbd.tv/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://mytvbd.tv/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved