seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
http://mymeaningfulrecovery.com
Your general SEO Checkup Score
Archived
75/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 75 out of 100, which is the same as the average score of 75. Our analysis has identified 21 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
21 Failed
3 Warnings
46 Passed
Common SEO issues
Score: 55
Failed: 6
Warnings: 1
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Meaningful Recovery – Online Recovery That Fits Your Life
Length: 57 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
http://mymeaningfulrecovery.comMeaningful Recovery – Online Recovery That Fits Your Life
Mobile version
http://mymeaningfulrecovery.comMeaningful Recovery – Online Recovery That Fits Your Life
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11lorem11ipsum10addiction7medications7recovery
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
lorem
ipsum
addiction
medications
recovery
Keywords Cloud Test
addictionadipiscingaffordablealcoholaliquaametanxietyappointmentavailablebeginblogbuprenorphinecarecasescomplaintconnectconsecteconsecteturcontactcontentconvenientcravingscyberdignitydisorderdolordoloredownloaddrugdummyeasyeiusmodelitemailemergencyfastfitsgivenhavehelphipaahomeincididuntincidiuntincludingindustryipsumlaborelifeloremmagnamakemeaningfulmedicationmedicationsmedicinemenumethadonemexiconaloxoneonlineopioidspatientspersonalizedphoneprescriptionspricingprintingprovidereadrecoveryrespectsecuredserviceservicessimplyskipsoftwarespecialistssprucestepstepssubstancesymptomstelemedicinetemportestingtexttodaytreattreatmenttrusttypesettingusedvideovideobyprovisitweekendswithdrawalworking
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Online Recovery That Fits Your Life
H2 tags
Video Visits on Your Smart phone or Computer
Easy and Affordable Pricing with At-Home Testing Options
Affordable Pricing
At Home Drug Testing
Transfer Patients Accepted!
What Can I Expect?
Trust Us with Your Addiction Treatment and Begin Your Recovery Today!
Our Successfully Completed Cases
Telemedicine that Fits Your Schedule
Steps to Recovery
Don't Hesitate to Contact Us and Begin Your Recovery Today
Meaningful Recovery of New Mexico
Copyright © 2022 All rights reserved.
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 50
Failed: 9
Warnings: 1
Passed: 8
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 29.0 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,199 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 182.88 Kb to 29.0 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 14.26 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
90.0 %
3.79 Mb
font
4.3 %
185.49 Kb
javascript
3.1 %
133.32 Kb
css
1.9 %
83.95 Kb
html
0.7 %
29.41 Kb
other
0.0 %
0 B
TOTAL
100%
4.22 Mb
Requests by content type
Content type
Percent
Requests
javascript
41.0 %
25
css
31.1 %
19
image
18.0 %
11
font
8.2 %
5
html
1.6 %
1
other
0.0 %
0
TOTAL
100%
61
Content size by domain
Domain
Percent
Size
mymeaningfulrecovery.com
97.4 %
4.11 Mb
fonts.gstatic.com
2.5 %
108.84 Kb
fonts.googleapis.com
0.1 %
2.96 Kb
TOTAL
100%
4.22 Mb
Requests by domain
Domain
Percent
Requests
mymeaningfulrecovery.com
91.8 %
56
fonts.gstatic.com
6.6 %
4
fonts.googleapis.com
1.6 %
1
TOTAL
100%
61
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
See results list
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 8.11 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

8.11 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Online Recovery That Fits Your Life We prescribe Suboxone (buprenorphine/naloxon...
Html: <div class="elementor-widget-wrap elementor-element-populated">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0

0.1

0.25

DOM element which contributes the most to CLS score:
Text: 1 (505) 596 - 4524
Html: <span class="elementor-icon-list-text">
Score: 0
Server and security
Score: 50
Failed: 4
Warnings: 0
Passed: 3
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: http://mymeaningfulrecovery.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="http://mymeaningfulrecovery.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:secureserver.net -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved