seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://muraaddecorations.com
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 85 out of 100, which is higher than the average score of 74. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
2 Warnings
50 Passed
Common SEO issues
Score: 71
Failed: 5
Warnings: 1
Passed: 18
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Muraad Decoration: Balloon Decoration Near Me, Birthday Decoration At Home, Balloon Decorations in Delhi, Mumbai, Jaipur & Bangalore
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Celebrate Anniversary, Birthday Party and other Special Occasions with Muraad Decorations experiences. Book Romantic Candlelight Dinners, Birthday Decoration, Balloon Decoration at home, Balloon Decorations, Home Surprises, Birthday Decoration Near Me, Private Dinners and more to make your loved ones feel special
Google Search Results Preview Test
Desktop version
https://muraaddecorations.comMuraad Decoration: Balloon Decoration Near Me, Birthday Decoration At Home, Balloon Decorations in Delhi, Mumbai, Jaipur & BangaloreCelebrate Anniversary, Birthday Party and other Special Occasions with Muraad Decorations experiences. Book Romantic Candlelight Dinners, Birthday Decoration, Balloon Decoration at home, Balloon Decorations, Home Surprises, Birthday Decoration Near Me, Private Dinners and more to make your loved ones feel special
Mobile version
https://muraaddecorations.comMuraad Decoration: Balloon Decoration Near Me, Birthday Decoration At Home, Balloon Decorations in Delhi, Mumbai, Jaipur & BangaloreCelebrate Anniversary, Birthday Party and other Special Occasions with Muraad Decorations experiences. Book Romantic Candlelight Dinners, Birthday Decoration, Balloon Decoration at home, Balloon Decorations, Home Surprises, Birthday Decoration Near Me, Private Dinners and more to make your loved ones feel special
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
22decoration5info4contact4delhi4muraaddecorations
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
addressakurlianniversaryarchavailablebabybackdropballoonballoonsbeginningbestbirthdayblackbossbouquetcandlecanopychromeclientscommittedcontactcopyrightcorporatecreatedecideddecorationdelhidetailsdikkidinnerdreamyemailenclaveequipmentfebruaryformfruitgallerygokulnagargoldhighesthomehotelhoursinfolatestlightmailmandirmarketplacematerialsmattlicmessagemistakesmovedmumbaimuraaddecorationsmuradnearnightnumberofficeopeningpartyphonepostspreviousproductqualityreadresultroadromanticroomroseroundsearchseedservicesshowershrinkingsilverstandstarsstepsubmitsurpriseteamtelephoneterracethemeumbrellaunicornusingvijaywantweedingwelcomewingedwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our newĀ Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator fromĀ SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
FacebookĀ PinterestĀ TwitterĀ 
Speed optimizations
Score: 96
Failed: 1
Warnings: 1
Passed: 14
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 21.95 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 129.74 Kb to 21.95 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 4.47 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
75.8 %
3.12 Mb
javascript
12.1 %
509.65 Kb
font
6.4 %
270.30 Kb
css
5.2 %
221.36 Kb
html
0.5 %
21.27 Kb
other
0.0 %
294 B
TOTAL
100%
4.12 Mb
Requests by content type
Content type
Percent
Requests
image
43.9 %
18
font
26.8 %
11
javascript
14.6 %
6
css
7.3 %
3
html
4.9 %
2
other
2.4 %
1
TOTAL
100%
41
Content size by domain
Domain
Percent
Size
muraaddecorations.com
80.1 %
3.30 Mb
backlinksmaker.com
15.1 %
637.30 Kb
googletagmanager.com
2.3 %
98.38 Kb
fonts.gstatic.com
1.9 %
79.64 Kb
googleadservices.com
0.3 %
14.53 Kb
fonts.googleapis.com
0.1 %
2.90 Kb
cdn.datatables.net
0.1 %
2.48 Kb
googleads.g.doubleclick.net
0.0 %
1.67 Kb
bid.g.doubleclick.net
0.0 %
683 B
google.com
0.0 %
548 B
Other
0.0 %
294 B
TOTAL
100%
4.12 Mb
Requests by domain
Domain
Percent
Requests
muraaddecorations.com
61.0 %
25
fonts.gstatic.com
14.6 %
6
googletagmanager.com
4.9 %
2
fonts.googleapis.com
2.4 %
1
cdn.datatables.net
2.4 %
1
googleadservices.com
2.4 %
1
google-analytics.com
2.4 %
1
googleads.g.doubleclick.net
2.4 %
1
google.com
2.4 %
1
backlinksmaker.com
2.4 %
1
Other
2.4 %
1
TOTAL
100%
41
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 94
Failed: 1
Warnings: 0
Passed: 7
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Mixed Content Test (HTTP over HTTPS)
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://muraaddecorations.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://muraaddecorations.com/" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 ip4:108.167.146.124 +a +mx ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved