seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.mountainviewhealthandwellness.ca
Your general SEO Checkup Score
Archived
93/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 93 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
1 Warnings
36 Passed
Common SEO issues
Score: 91
Failed: 3
Warnings: 0
Passed: 16
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: New Westminster & Surrey | Mountainview Health & Wellness
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Mountainview Health and Wellness is an multi-disciplinary wellness clinics in New Westminster and Surrey. The Services range from; physiotherapy, kinesiology, massage therapy, occupational therapy, acupuncture, dietitian , chiropractics, clinical counselling, psychology, osteopathy, FCE, ICBC rehab, active rehab, RTW
Google Search Results Preview Test
Desktop version
https://www.mountainviewhealthandwellness.caNew Westminster & Surrey | Mountainview Health & WellnessMountainview Health and Wellness is an multi-disciplinary wellness clinics in New Westminster and Surrey. The Services range from; physiotherapy, kinesiology, massage therapy, occupational therapy, acupuncture, dietitian , chiropractics, clinical counselling, psychology, osteopathy, FCE, ICBC rehab, active rehab, RTW
Mobile version
https://www.mountainviewhealthandwellness.caNew Westminster & Surrey | Mountainview Health & WellnessMountainview Health and Wellness is an multi-disciplinary wellness clinics in New Westminster and Surrey. The Services range from; physiotherapy, kinesiology, massage therapy, occupational therapy, acupuncture, dietitian , chiropractics, clinical counselling, psychology, osteopathy, FCE, ICBC rehab, active rehab, RTW
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
12health7wellness6therapy4services4help
Keywords Cloud Test
achieveacneacupunctureareasbettercarecareerscaringchildrenchiropracticchooseclientsclinicalcolumbiacombinationcomfortableconsultantcontactcounsellingcoursescranialdentaldentistrydesiredietitianearseentemersonenvironmentexperienceexpertiseexpertsextensivefamilyfollowingfridaygmailharryhealthhealthyhelphirehomehoursinfoinvitekinesiologylaserlearnlevellifestylemassagemondaymountainviewmountainviewhealthnoseoccupationalopeningoralorientedosteopathypedorthistphysiotherapypodiartyprofessionalsqualifiedralphreceptionmvhwreferralsrelatedrelaxedsacralsaturdayseekingselectionserveservicesshockwavesidhuskinspecializationstopstreetsurreyteamtestimonialstherapythroattreatmentvibrantwaldowealthwellnesswestminsterwomen
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Your Wellness Experts
"The first wealth is health"
H2 tags
MOUNTAINVIEW HEALTH AND WELLNESS SERVICES
Mountainview Health And Wellness
Services
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage doesn't use "img" tags.
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 81
Failed: 3
Warnings: 1
Passed: 9
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 1895.34 Kb to 171.46 Kb (91% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.84 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 50
  • 1 HTML Pages
  • 0 CSS Files
  • 37 JS Files
  • 12 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Your website does not use any CSS files!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 5
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 10 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 4
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved