seo site checkup logo
PricingFree ToolsArticles
Report generated 9 days ago
http://masterlocksmith360.com
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 85 out of 100, which is higher than the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
3 Warnings
58 Passed
Issues to fix
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 75
Failed: 6
Warnings: 1
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Expert Auto Locksmith Tools for Your Vehicle
Length: 44 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 73 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: our emergency lockout services mobile locksmith 24 hour locksmith Phoenix
Length: 73 characters
Google Search Results Preview Test
Desktop version
https://masterlocksmith360.com/Expert Auto Locksmith Tools for Your Vehicleour emergency lockout services mobile locksmith 24 hour locksmith Phoenix
Mobile version
https://masterlocksmith360.com/Expert Auto Locksmith Tools for Your Vehicleour emergency lockout services mobile locksmith 24 hour locksmith Phoenix
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://masterlocksmith360.com/
og:site_name
Master locksmith
og:title
Master locksmith
og:description
Expert solutions for all your lock and key needs.
og:type
website
og:image
https://img1.wsimg.com/isteam/getty/813283742
og:locale
en_US
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
26services20locksmith9master8safe8lock
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
services
locksmith
master
safe
lock
Keywords Cloud Test
accessaffordableareaassetsassistanceautomotiveavailablebelongingsbestbusinessbusinessescarechangeschangingcombinationcomercialcommercialcomprehensivecontactcontrolcookiescustomersdeservesefficientlyemailemergencyemployeesensuringexistingexperienceexperiencedexpertfamilyfreefrustratinggettinghandlehelphighhomeincludeincludinginstallationkeyslistlocklockedlockoutlockslocksmithmaintenancemastermindmissionmobileneedsnotchofferoffersofficepeacepricepricesprioritizepriorityprofessionalprofessionalismprotectingprovidequicklyquoterangeregainreliablerepairreplacementresidentialsafesafeguardsafessafetysecuresecurityserviceservicessignsituationskilledsolutionssystemsteamtechnicianstimelytrustunauthorizedunderstandunderstandsuniquewebsitewelcome
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Reliable Keys and Locksmith Services in Your Area lock changing service
H2 tags
Price List
Our Happy Customers
See Why Our Clients Love Us
Contact Us
Subscribe
My Blog
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 97
Failed: 2
Warnings: 1
Passed: 22
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 30.35 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,016 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 186.56 Kb to 30.35 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.9 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
56.0 %
276.57 Kb
font
19.7 %
97.22 Kb
image
14.6 %
72.09 Kb
html
9.7 %
48.14 Kb
css
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
494.02 Kb
Requests by content type
Content type
Percent
Requests
javascript
72.9 %
35
image
14.6 %
7
font
8.3 %
4
html
4.2 %
2
css
0.0 %
0
other
0.0 %
0
TOTAL
100%
48
Content size by domain
Domain
Percent
Size
img1.wsimg.com
90.1 %
444.90 Kb
masterlocksmith360.com
9.7 %
48.14 Kb
cdn.reamaze.com
0.1 %
530 B
events.api.secureserver.net
0.1 %
468 B
TOTAL
100%
494.02 Kb
Requests by domain
Domain
Percent
Requests
img1.wsimg.com
89.6 %
43
masterlocksmith360.com
4.2 %
2
events.api.secureserver.net
4.2 %
2
cdn.reamaze.com
2.1 %
1
TOTAL
100%
48
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.012 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.012 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.515 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.515 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.46 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.46 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img data-ux="HeaderMediaImage" src="https://img1.wsimg.com/isteam/getty/813283742/:/" data-ht="Inset" data-aid="BACKGROUND_IMAGE_RENDERED" headertreatment="Inset" class="x-el x-el-img c1-1 c1-2 c1-4 c1-20 c1-2c c1-2d c1-...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0379. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0379

0.1

0.25

DOM element which contributes the most to CLS score:
Text: 602-789-4441 Reliable Keys and Locksmith Services in Your Area lock changing se...
Html: <div data-ux="SectionContainer" class="x-el x-el-div c1-1 c1-2 c1-17 c1-2d c1-t c1-u c1-2...">
Score: 0.0361
Server and security
Score: 83
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "masterlocksmith360.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
masterlocksmith360.com
Subject Alternative Names (SANs)
www.masterlocksmith360.com, masterlocksmith360.com
Not valid before
Sun, February 23o 2025, 3:55:45 pm (z)
Not valid after
Sat, May 24o 2025, 3:55:45 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Secure Certificate Authority - G2
Intermediate certificate
Common name
Go Daddy Secure Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, May 3o 2011, 7:00:00 am (z)
Not valid after
Sat, May 3o 2031, 7:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Root certificate
Common name
Go Daddy Root Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, September 1o 2009, 12:00:00 am (z)
Not valid after
Thu, December 31o 2037, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=63072000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
Server: DPS/2.0.0+sha-d969522
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 3
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved