seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://lyrics-in-hindi.com/bhajans
Your general SEO Checkup Score
Archived
80/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 80 out of 100, which is higher than the average score of 74. Our analysis has identified 11 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
1 Warnings
60 Passed
Common SEO issues
Score: 68
Failed: 6
Warnings: 0
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Bhajan Collections – bhajan and bhakti gaane lyrics sangrah
Length: 60 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://lyrics-in-hindi.com/bhajansBhajan Collections – bhajan and bhakti gaane lyrics sangrah
Mobile version
https://lyrics-in-hindi.com/bhajansBhajan Collections – bhajan and bhakti gaane lyrics sangrah
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
77lyrics61bhajan31bhajans16post16comments
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
lyrics
bhajan
bhajans
post
comments
Keywords Cloud Test
aartibababansuribarsanebestbhajanbhajansbhaktibhojpuricategoriescategorychalisaclosecollcitosncollectionscommentsconditionscontactcontentcontinuedalodededengedeshbhaktidisclaimerdisplayeddiwanadurgaeducationalenglishfontsgaaneganeshgayageetgmailgujratigujrihanumanharyanvihindiholihomeinquiryjaungajivankahekalakanhakhatukrishnalalalatestlyricsmainmaiyameinmenumerimilkemopenagarnandalalaolderoldestownerspolicypostpostsprivacypunjabipurposesradharadhikerajsthanirangreadingrecentrespectivesangsangrahsearchshayamshivshyamsiteskipsongstamilteretermswebsite
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
bhajan and bhakti gaane lyrics sangrah
H2 tags
दिल दीवाना श्याम का भजन लिरिक्स भजन लिरिक्स Dil Diwana Shyam Ka Bhajan Lyrics
मैं अब न जाऊँगा राधा तेरे संग भजन लिरिक्स भजन लिरिक्स Main Ab Na Jaunga Radha Tere Sang Bhajan Lyrics
काला काला कहे गुजरी भजन लिरिक्स भजन लिरिक्स Kala Kala Kahe Gujri Bhajan Lyrics
मेरी बांसुरी का देदे सुर ताल राधिके भजन लिरिक्स भजन लिरिक्स Meri Bansuri Ka Dede Sur Tal Radhike Bhajan Lyrics
ओ जब से श्याम नाम जीवन में आ गया भजन लिरिक्स भजन लिरिक्स O Jab Se Shyam Nam Jivan Mein A Gaya Bhajan Lyrics
नंदलाला ने बरसाने में भजन लिरिक्स भजन लिरिक्स Nandalala Ni Barsane Mein Bhajan Lyrics
कान्हा मोपे रंग ना डालो भजन लिरिक्स भजन लिरिक्स Kanha Mope Rang Na Dalo Bhajan Lyrics
काले कान्हा को कर देंगे लाल मिलके हिंदी भजन लिरिक्स भजन लिरिक्स Kala Kanha Ko Kar Denge Lala Milke Hindi Bhajan Lyrics
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage doesn't use "img" tags.
Responsive Image Test38% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 93
Failed: 1
Warnings: 1
Passed: 21
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 15.97 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,385 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 83.78 Kb to 15.97 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.85 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
font
59.4 %
108.93 Kb
css
31.0 %
56.73 Kb
html
9.0 %
16.50 Kb
javascript
0.6 %
1.09 Kb
image
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
183.24 Kb
Requests by content type
Content type
Percent
Requests
css
55.6 %
5
font
22.2 %
2
html
11.1 %
1
javascript
11.1 %
1
image
0.0 %
0
other
0.0 %
0
TOTAL
100%
9
Content size by domain
Domain
Percent
Size
lyrics-in-hindi.com
100.0 %
183.24 Kb
TOTAL
100%
183.24 Kb
Requests by domain
Domain
Percent
Requests
lyrics-in-hindi.com
100.0 %
9
TOTAL
100%
9
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.54 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.54 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: काला काला कहे गुजरी भजन लिरिक्स भजन लिरिक्स 9, bhakti Bhajans Songs :-Kala Kala ...
Html:

काला काला कहे गुजरी भजन लिरिक्स भजन लिरिक्स 9, bhakti Bhajans Songs :-Kala Kala Kahe Gujri Bhajan Lyrics काला काला कहे गुजरी भजन लिरिक्स काला काला करे गुजरीमत काले का…

Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0004

0.1

0.25

DOM element which contributes the most to CLS score:
Text: bhajan collections Durga Maiya Hanuman ji khatu shayam Krishna ji Rajsthani bhaj...
Html: <div id="site-navigation-wrap" class="clr">
Score: 0.0004
Server and security
Score: 79
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "lyrics-in-hindi.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.lyrics-in-hindi.com
Subject Alternative Names (SANs)
*.lyrics-in-hindi.com, lyrics-in-hindi.com
Not valid before
Sat, November 5o 2022, 3:48:54 pm (z)
Not valid after
Fri, February 3o 2023, 3:48:53 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 62
Failed: 2
Warnings: 0
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved