seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://linhkienstore.vn
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 77 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
4 Warnings
32 Passed
Common SEO issues
Score: 75
Failed: 3
Warnings: 2
Passed: 13
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Linh Kiện Store - Chuyên Loa kéo, Flycam, Camera, Smarthome và Đồ chơi công nghệ
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Chuyên phân phối các sản phẩm như loa kéo, loa kẹo kéo, loa vali kéo di động, Flycam DJI, Flycam Mavic, Flycam hubsan, gimbal chống rung, nhà thông minh smarthome, camera hành trình Gopro, SJcam, eken, gitup. Camera ngụy trang, Camera siêu nhỏ, camera quay lén, tay cầm chơi game, chuột game, tai nghe gaming, tại Tp Hồ Chí Minh và Cần Thơ
Google Search Results Preview Test
Desktop version
https://linhkienstore.vnLinh Kiện Store - Chuyên Loa kéo, Flycam, Camera, Smarthome và Đồ chơi công nghệChuyên phân phối các sản phẩm như loa kéo, loa kẹo kéo, loa vali kéo di động, Flycam DJI, Flycam Mavic, Flycam hubsan, gimbal chống rung, nhà thông minh smarthome, camera hành trình Gopro, SJcam, eken, gitup. Camera ngụy trang, Camera siêu nhỏ, camera quay lén, tay cầm chơi game, chuột game, tai nghe gaming, tại Tp Hồ Chí Minh và Cần Thơ
Mobile version
https://linhkienstore.vnLinh Kiện Store - Chuyên Loa kéo, Flycam, Camera, Smarthome và Đồ chơi công nghệChuyên phân phối các sản phẩm như loa kéo, loa kẹo kéo, loa vali kéo di động, Flycam DJI, Flycam Mavic, Flycam hubsan, gimbal chống rung, nhà thông minh smarthome, camera hành trình Gopro, SJcam, eken, gitup. Camera ngụy trang, Camera siêu nhỏ, camera quay lén, tay cầm chơi game, chuột game, tai nghe gaming, tại Tp Hồ Chí Minh và Cần Thơ
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
221hành137hàng130tháng122camera110thêm
Keywords Cloud Test
androidbassbluetoothbungbìnhcamerachuẩnchínhchúngchơichấtchốngcombocôngdungdươngdịchdụngekenflycamflydigifreeshipgamegiangimbalgiámgiảigănghoạthànghànhhìnhkhiểnkháckháchkhóakhôngkiệnkíchlinhliênlượnglạnhmicrominhminingaynghenghệnguồnngàyngườingụynhiệtnăngnướcphânphòngphútphảiphẩmquayrungrộngsjcamsmartstingersuấtthiếtthuậtthángthêmthôngthùngthướcthờitiếngtphcmtrangtrongtrìnhtrạitrọngtrụctuyatínhtặngvideoviềnvòngwifiwonlexxanhxiaomiđiềuđiệnđượcđịnhđồngđộng
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Linh Kiện Store - Chuyên Loa kéo, Flycam, Camera, Smarthome và Đồ chơi công nghệ
H2 tags
Tay cầm chơi game GameSir G4 Pro
Loa kéo Dalton TS-12G400X
Flycam DJI Mavic Air 2S Combo
Loa kéo JBZ 0815
Combo Camera Hành Trình EKEN H9R Và Thẻ Nhớ SANDISK ULTRA A1 CLASS 10 16GB
Loa Google Home Mini
Trọn gói nhà thông minh BKAV nhỏ 2 phòng ngủ
Flycam Xiaomi X8 SE
Loa kéo Dalton TS-18G800U
Flycam Xiaomi Mi Drone 4K
Đồng hồ định vị trẻ em Wonlex KT15
Camera hành trình Eken H9R V8.1
Full combo nút bắn Flydigi Stinger 2 trái phải
Flycam Hubsan Zino Pro Combo
Loa kéo Hosan KG15-18
Tai nghe Bluetooth HBS 900
Loa kéo di động sansui A12-66
Loa bluetooth Thonet & Vander Frei Portable
Nút phụ kiện chơi PUBG Mobile
Loa kéo KTV SS1-12 – nhỏ gọn, giá cực rẻ
LOA VALI KÉO
Loa kéo Acnos KBNet41
Loa kéo Zansong R19
Loa kéo Acnos CS390
Loa kéo Hosan J3600
Loa kéo JBZ 0615
Loa kéo Prosing W18C
Loa kéo Hosan J8200
Loa kéo Acnos CBX15G
FLYCAM
Flycam Xiaomi FIMI X8 Mini
DJI FPV Combo
Combo Flycam C-Fly Faith 2
Flycam ZLRC SG906 Pro 3 Max
Flycam C-Fly Faith 2
Combo Flycam DJI Mavic Mini 2
Flycam MJX Bugs 12 EIS
Flycam DJI Mavic Mini 2
Flycam SJRC F11S 4K PRO
ĐỒNG HỒ THÔNG MINH
Đồng hồ thông minh định vị trẻ em Wonlex KT20
Đồng hồ thông minh Finow Q2
Đồng hồ thông minh định vị trẻ em Wonlex Q50
Đồng hồ thông minh định vị trẻ em Wonlex KT12
Đồng hồ thông minh định vị trẻ em Wonlex KT11
Đồng hồ thông minh định vị trẻ em Wonlex KT04
Đồng hồ thông minh định vị trẻ em Wonlex KT01
Đồng hồ thông minh Lemfo Lem5 Pro
Đồng hồ thông minh Finow X7
CAMERA HÀNH TRÌNH
Camera hành trình SJCAM C200
Camera hành trình SJCAM SJ10 Pro
Camera hành trình SJCAM SJ8 Pro Wifi 4K
Camera hành trình SJCAM SJ6 Legend wifi 4K
Camera hành trình SJCAM M20- quay 4K, chống rung Gyro
Camera hành trình SJCAM SJ5000 wifi Full HD 1080
Camera hành trình SJCAM SJ4000 Wifi chính hãng giá rẻ
Combo Camera Hành Trình EKEN H9R Pin Dự Phòng Và Dock Sạc Đôi
Combo Camera Hành Trình SJCAM SJ8 Pro Pin Dự Phòng Và Dock Sạc Đôi
GAMING GEAR
Nút bắn Flydigi Stinger 2 full trái/ phải
Tay cầm chơi game GameSir T4 Pro
Nút bấm chơi game RAWM CLAW
Tay cầm chơi game Flydigi Apex 2
Flydigi Stinger 2 – Nút Bắn Phụ Trái/Phải
Flydigi Stinger 2 – Nút Bắn Chính Trái/Phải
Quạt tản nhiệt Flydigi Wasp Wing Pro
Tay cầm chơi game Flydigi Wasp 2 Pro
Bộ chuyển đổi Game LingZha 2
CAMERA GIÁM SÁT
Camera ngụy trang đồng hồ treo tường BW23
Camera bóng đèn V380 A10
Camera ngụy trang nút áo S908
Camera ngụy trang modem wifi Tenda R04
Camera ngụy trang quẹt ga WL06
Camera nguỵ trang đồng hồ đeo tay W189A
Camera ngụy trang V99 phiên bản 120 độ
Camera nguỵ trang đồng hồ treo tường WC16B
Camera nguỵ trang đồng hồ treo tường WC74
Camera ngụy trang V99 WM13
SMARTHOME
Khóa cửa vân tay Tuya X2 vàng đồng
Khoá cửa sắt Tuya R5
Khóa cửa vân tay Xiaomi Mijia Pro
Công tắc cảm ứng Tuya 1 nút viền vàng wifi
Công tắc cảm ứng Tuya 1 nút viền vàng zigbee
Công tắc cảm ứng Tuya 4 nút viền vàng zigbee
Công tắc cảm ứng Tuya 4 nút viền vàng wifi
Công tắc cảm ứng Tuya 2 nút viền vàng wifi
Công tắc cảm ứng Tuya 2 nút viền vàng zigbee
Công tắc cảm ứng Tuya 3 nút viền vàng zigbee
GIMBAL CHỐNG RUNG
Gimbal chống rung Moza Mini P
Gimbal chống rung Feiyu Vlog Pocket 2
Gimbal chống rung Zhiyun Smooth XS
Gimbal chống rung DJI Osmo Mobile 4
Gimbal chống rung Zhiyun Smooth X
Gimbal chống rung Moza AirCross 2 Professional Kit
Gimbal chống rung Feiyu Vimble 2S
Gimbal chống rung DJI Osmo Mobile 3 Combo
Gimbal chống rung Zhiyun Smooth Q2
Gimbal chống rung Feiyu Vlog Pocket
LỀU DU LỊCH
Lều cắm trại 2 người xanh lam
Lều cắm trại 2 người xanh quân đội
Bộ bàn ghế dã ngoại
Đèn bão LED 9789
Gậy Trekking 3 khúc chống sốc Trackman
Lều cắm trại JingTian tự bung SY-T03 xanh dương
Lều cắm trại JingTian tự bung SY-T04 xanh dương
Lều cắm trại JingTian tự bung SY-T01 xanh dương
Lều cắm trại JingTian tự bung SY-T03 xanh lá
Lều cắm trại JingTian tự bung SY-T01 xanh lá cây
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
JS Error Test
  • We've found JavaScript errors on your webpage!
See results list
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook Google Plus 
Speed optimizations
Score: 83
Failed: 2
Warnings: 2
Passed: 11
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 568.41 Kb to 59.99 Kb (89% size savings). This helps ensure a faster loading webpage and improved user experience.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 193
  • 2 HTML Pages
  • 22 CSS Files
  • 35 JS Files
  • 134 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Your website is not using cache headers for all JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 68
Failed: 2
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Server Signature Test
Server: Apache/2
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 3 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 44
Failed: 2
Warnings: 0
Passed: 3
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://linhkienstore.vn is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://linhkienstore.vn/" rel="canonical"/>
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:zoho.com ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved