seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://kudos-wheels.co.uk
Your general SEO Checkup Score
Archived
92/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 92 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
0 Warnings
40 Passed
Common SEO issues
Score: 92
Failed: 2
Warnings: 0
Passed: 18
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Kudos Wheels - Hire Carbon Bike Wheels from £25 per day!
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Kudos Wheels - Hire carbon bike wheels for your next cycling holiday or event. Why spend a fortune on a pair of carbon bike wheels that you only use a few times a year, when you can hire them for a fraction of the cost? Go faster with brands including the ZIPP, DT Swiss and Mavic Comete!
Google Search Results Preview
Desktop version
https://kudos-wheels.co.ukKudos Wheels - Hire Carbon Bike Wheels from £25 per day!Kudos Wheels - Hire carbon bike wheels for your next cycling holiday or event. Why spend a fortune on a pair of carbon bike wheels that you only use a few times a year, when you can hire them for a fraction of the cost? Go faster with brands including the ZIPP, DT Swiss and Mavic Comete!
Mobile version
https://kudos-wheels.co.ukKudos Wheels - Hire Carbon Bike Wheels from £25 per day!Kudos Wheels - Hire carbon bike wheels for your next cycling holiday or event. Why spend a fortune on a pair of carbon bike wheels that you only use a few times a year, when you can hire them for a fraction of the cost? Go faster with brands including the ZIPP, DT Swiss and Mavic Comete!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
15wheels6zipp5personalised5cycling4faqs
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
bikebookbrowsecarboncartchargechooseclickclosecollapsecomboscometeconditionscontentcyclingdatesdeliverdoorduathloneventexpandexpand/collapsefacebookfaqsfastfreehavinghelphireinstagramironmankudosleadinglikelongmavicneednewspersonalisedpickpoweredracerentrequestridesearchselectionsellserviceshadowshimanoshirtshirtsshopifyskipspeedspendstartedsubmitswisstermstimestimetrialtodaytriathlonuk'sviewwantwe'llwe'rewheelwheelsworksyearyou'dzipp
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H2 tags
Rent Carbon Race Wheels
The UK's leading wheel hire service
How it works
We also sell personalised cycling T Shirts
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
AddThis Facebook 
Speed optimizations
Score: 73
Failed: 3
Warnings: 0
Passed: 10
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 18.83 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 75.08 Kb to 18.83 Kb (75% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 1.78 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 49
  • 3 HTML Pages
  • 4 CSS Files
  • 18 JS Files
  • 24 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 11 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 70
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://kudos-wheels.co.uk/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://kudos-wheels.co.uk/" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:spf.protection.outlook.com -all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved