seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://indiantraveldictionary.com
Your general SEO Checkup Score
Archived
61/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 61 out of 100, which is below the average score of 74. However, there are 19 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
19 Failed
5 Warnings
38 Passed
Common SEO issues
Score: 69
Failed: 6
Warnings: 2
Passed: 17
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Best Tour Operator And Travel Agents in Delhi 2022
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Travel Agents in India 2022: Indian Travel Dictionary offer wide range of Tour Operator and Travel Agency in Delhi, Gurgaon and Delhi NCR. India Tour And Holiday Packages at Reasonable.
Google Search Results Preview Test
Desktop version
https://indiantraveldictionary.comBest Tour Operator And Travel Agents in Delhi 2022Travel Agents in India 2022: Indian Travel Dictionary offer wide range of Tour Operator and Travel Agency in Delhi, Gurgaon and Delhi NCR. India Tour And Holiday Packages at Reasonable.
Mobile version
https://indiantraveldictionary.comBest Tour Operator And Travel Agents in Delhi 2022Travel Agents in India 2022: Indian Travel Dictionary offer wide range of Tour Operator and Travel Agency in Delhi, Gurgaon and Delhi NCR. India Tour And Holiday Packages at Reasonable.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
38dictionary17india13destination13destinations10popular
Keywords Usage Test81% of top 100 sites passed
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
activityadventureagentsamazingattractionayurvedabackwatersbangalorebeachbookbreakbroadlycentralchancechennaicitiescityconfusioncontactcontaminationcontentcruiseculturalculturedelhidestinationdestinationsdetailsdictionarydistractedeastenquireestablishedexcursionsexperiencedexplorefactfocalgatewaygatewaysgetawaysheritagehillhimachalhistoricalhoneymoonhyderabadhydrabadindiakashmirkeralakolkataladakhlearnlearninglifelikelivelocationslongluxurymagnificencemahalmemorablemumbainavigationnearnecessarynorthoffbeatonlinepackagespearlspilgrimageplacespointpopularrajasthanreadreadablereadersouthstationterritoriestoggletourtouriststourstrainstraveltrendingtrulyunionvillageweekweekendwestwildwildlifeyoga
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
100
75
1200
500
H2 tags
WEEKEND GETAWAYS NEAR YOU DELHI WILDLIFE
WEEKEND GETAWAYS NEAR YOU DELHI HERITAGE
WEEKEND GETAWAYS NEAR YOU DELHI PILGRIMAGE
Trending Tours Dictionary
Most Popular Destinations
Beach Destination
Offbeat Dictionary
Wild Life Dictionary
Historical Destinations
Pilgrimage Destinations
Adventure Dictionary
Hill Destination
Honeymoon Dictionary
Top 10 Weekend Gateway Dictionary in India
India Tour By Region
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="utf-8"
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 44
Failed: 9
Warnings: 2
Passed: 8
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 8.16 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,931 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 5.4 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
95.8 %
11.84 Mb
javascript
2.7 %
335.45 Kb
font
0.7 %
90.22 Kb
css
0.7 %
84.79 Kb
html
0.1 %
15.46 Kb
other
0.0 %
36 B
TOTAL
100%
12.36 Mb
Requests by content type
Content type
Percent
Requests
image
46.7 %
35
javascript
24.0 %
18
css
20.0 %
15
html
4.0 %
3
font
2.7 %
2
other
2.7 %
2
TOTAL
100%
75
Content size by domain
Domain
Percent
Size
indiantraveldictionary.com
98.9 %
12.23 Mb
googletagmanager.com
0.9 %
113.13 Kb
google-analytics.com
0.2 %
19.96 Kb
TOTAL
100%
12.36 Mb
Requests by domain
Domain
Percent
Requests
indiantraveldictionary.com
93.3 %
70
google-analytics.com
4.0 %
3
googletagmanager.com
2.7 %
2
TOTAL
100%
75
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test98% of top 100 sites passed
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 3.4 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.4 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="fill" style="background-image:url('banner/1.jpg');">
Server and security
Score: 75
Failed: 2
Warnings: 0
Passed: 6
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "indiantraveldictionary.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.indiantraveldictionary.com
Subject Alternative Names (SANs)
*.indiantraveldictionary.com, indiantraveldictionary.com
Not valid before
Sun, August 7o 2022, 2:31:34 pm (z)
Not valid after
Sat, November 5o 2022, 2:31:33 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 38
Failed: 2
Warnings: 1
Passed: 4
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
SPF Records Test94% of top 100 sites passed
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved