seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://igcritic.com/batman-arkham-knight-review
Your general SEO Checkup Score
Archived
78/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 78 out of 100, which is higher than the average score of 75. Our analysis has identified 7 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
7 Failed
2 Warnings
29 Passed
Common SEO issues
Score: 75
Failed: 2
Warnings: 1
Passed: 12
Google Search Results Preview Test
Desktop version
http://igcritic.com/batman-arkham-knight-review/Batman Arkham Knight review - IGCriticBatman: Arkham Knight is set one year after Batman: Arkham City. Scarecrow (who left only his eeriness in Arkham City if you were bothered to find it and decipher it) is back in town and he’s joined forces with Two-Face, Harley Quinn, Penguin and the mysterious Arkham Knight to once more try and obliterate the caped crusader; Gotham’s shadowy beacon of hope.
Mobile version
http://igcritic.com/batman-arkham-knight-review/Batman Arkham Knight review - IGCriticBatman: Arkham Knight is set one year after Batman: Arkham City. Scarecrow (who left only his eeriness in Arkham City if you were bothered to find it and decipher it) is back in town and he’s joined forces with Two-Face, Harley Quinn, Penguin and the mysterious Arkham Knight to once more try and obliterate the caped crusader; Gotham’s shadowy beacon of hope.
Keywords Cloud Test
addictivearkhamarmedarticleasylumbatmanbatman’sbatmobilebattlefrontbattlescityclassiccultdoesdronesemailfalloutfantasyfearfeelsfifafightfinalforcedgamegameplaygamesgothamgotham’sguildharleyhaven’theadedhearhe’shugehuntit’sjustkillerknightkyleleftlikelittlelivelymissionsnewsnightopenoxenfreepenguinplaceplayplotpoisonpolicypredatorpresentedpreviouspsychonautsquinnreadreallyrefinedrepetitivereplyreviewreviewjanuaryreviewsriddlerroomrunningscarecrowsearchingsenseseriessimplystarstorystreetstankthey’rethinkthugstoxintrovetryingtwistsunmannedunnecessaryvillainsvoicewarswasn’twildwitcherxboxyearsyou’ll
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
SEO Friendly URL Test
  • This analyzed URL is SEO friendly but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 46 'img' tags and 16 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 63 inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Social Media Test
Speed optimizations
Score: 70
Failed: 3
Warnings: 1
Passed: 6
HTML Page Size Test
  • Congratulations! Your HTML size is 19.03 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 98.96 Kb to 19.03 Kb (81 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 78.174 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 673
  • 173 HTML Pages
  • 25 CSS Files
  • 63 JS Files
  • 378 Images
  • 34 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Warning: your website contains flash objects. Flash is an outdated technology that is used to deliver rich multimedia content. Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
See results list
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
Server and security
Score: 0
Failed: 0
Warnings: 0
Passed: 5
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 38
Failed: 2
Warnings: 0
Passed: 3
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://igcritic.com/batman-arkham-knight-review/" />
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved