seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://home.deds.nl/~beleggen/index.html
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 77 out of 100, which is higher than the average score of 75. Our analysis has identified 12 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
1 Warnings
54 Passed
Common SEO issues
Score: 81
Failed: 4
Warnings: 0
Passed: 22
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: Beleggen voor beginners: Beste online brokers Nederland
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Beginnen met beleggen is een flinke stap. Daarom leggen we graag uit wat beleggen is, hoe het werkt en hoe jij kunt starten met beleggen! Ontdek hier meer.
Google Search Results Preview Test
Desktop version
https://home.deds.nl/~beleggen/index.htmlBeleggen voor beginners: Beste online brokers NederlandBeginnen met beleggen is een flinke stap. Daarom leggen we graag uit wat beleggen is, hoe het werkt en hoe jij kunt starten met beleggen! Ontdek hier meer.
Mobile version
https://home.deds.nl/~beleggen/index.htmlBeleggen voor beginners: Beste online brokers NederlandBeginnen met beleggen is een flinke stap. Daarom leggen we graag uit wat beleggen is, hoe het werkt en hoe jij kunt starten met beleggen! Ontdek hier meer.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
nl_NL
og:type
article
og:title
Beleggen voor beginners: Beste online brokers Nederland
og:site_name
Beleggen voor Beginners
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
9beleggen7voor4beginners3https2weten
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
aanbevolenaandelenalleenautomatischaveragingbeginnenbeginnersbekijkbelegbeleggenbeleggingsstrategiebepaalbestbestebrokerscheckcoinmarketcapconsumentenbondcostcursusdividendrendementdoeldogsdollardoorexpertsgaangaatgeldgravitygrondstoffenhandigehighholdhttpshypehypothekeninformatiekieskuntlaatlifecyclelinkedinmeermeeslepenmissenmoetmomentmscinietobligatiesprofilescoresellstartstrategiestrategieënsuccesvolletipsvastgoedvolgendevoorwelkeweten
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Congratulations! Your webpage contains headings tags.
H1 tags
Dit moet je weten voor je gaat beleggen!
H2 tags
Wil je ook gaan beleggen? Bekijk 5 handige tips voor een succesvolle start.
De beste beleggingsstrategie voor beginners
Robots.txt Test94% of top 100 sites passed
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • Your website lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • Your webpage doesn't use "img" tags.
Responsive Image Test38% of top 100 sites passed
  • All images in this page are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Congratulations! Your webpage is not using any inline CSS styles.
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="UTF-8"
Social Media Test80% of top 100 sites passed
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 86
Failed: 2
Warnings: 0
Passed: 18
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 2.77 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 125 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 58% - from 2.77 Kb to 1.17 Kb .
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 0.64 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Content size by content type
Content type
Percent
Size
html
100.0 %
3.03 Kb
css
0.0 %
0 B
javascript
0.0 %
0 B
image
0.0 %
0 B
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
3.03 Kb
Requests by content type
Content type
Percent
Requests
html
100.0 %
1
css
0.0 %
0
javascript
0.0 %
0
image
0.0 %
0
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
1
Content size by domain
Domain
Percent
Size
home.deds.nl
100.0 %
3.03 Kb
TOTAL
100%
3.03 Kb
Requests by domain
Domain
Percent
Requests
home.deds.nl
100.0 %
1
TOTAL
100%
1
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not using images, javascript or css resources from your domain.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test98% of top 100 sites passed
  • Your webpage is not using uncached JavaScript resources from your domain.
CSS Caching Test98% of top 100 sites passed
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test93% of top 100 sites passed
  • Your webpage is not using JavaScript resources from the same domain.
See results list
CSS Minification Test97% of top 100 sites passed
  • Your webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 65
Failed: 2
Warnings: 0
Passed: 6
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "home.deds.nl" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.deds.nl
Subject Alternative Names (SANs)
*.deds.nl, deds.nl
Not valid before
Sat, October 2o 2021, 12:00:00 am (z)
Not valid after
Thu, October 20o 2022, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 62
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 43
Failed: 3
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://home.deds.nl/~beleggen/index.html is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://home.deds.nl/~beleggen/index.html" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved