seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://glow-demo.web.app
Your general SEO Checkup Score
Archived
96/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 96 out of 100, which is higher than the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
1 Warnings
58 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 78
Failed: 4
Warnings: 1
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 69 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Find the Best Skincare Products for Your Skin Type | Skincare Advisor
Length: 69 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Find personalized skincare product recommendations based on your skin type and concerns. Get data-driven insights to make informed skincare decisions.
Length: 150 characters
Google Search Results Preview Test
Desktop version
https://glow-demo.web.app/Find the Best Skincare Products for Your Skin Type | Skincare AdvisorFind personalized skincare product recommendations based on your skin type and concerns. Get data-driven insights to make informed skincare decisions.
Mobile version
https://glow-demo.web.app/Find the Best Skincare Products for Your Skin Type | Skincare AdvisorFind personalized skincare product recommendations based on your skin type and concerns. Get data-driven insights to make informed skincare decisions.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Find the Best Skincare Products for Your Skin Type | Skincare Advisor
og:description
Our AI tool helps you find which skincare products fit your skin type and concerns. Get personalized recommendations based on real user reviews.
og:site_name
Skincare Advisor
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
13skin8cleanser8pores6skincare6cleansing
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
skin
cleanser
pores
skincare
cleansing
Keywords Cloud Test
acidactionadvisorbalancebestbreakingbuildupbuiltcausecheekschincleansercleansingclearercombinationcomboconcernsconfidenceconfusingcustomerdeepdifferentdissolvesdoesndrivendryingenlargedexcessextractfacefitsfoamfoamingformulafullygentleglowwwhaveheartleafheavyhellhelphomehydrationinsightsirritationlifelookinglovedmaintainingmakemakeupmatchmatchedmixedneedoilypickedporeporesproductproductsprovidepullingpurchasepurifyrecommendedrecsregretremoveretinolreviewssalicylicsebumsensitiveserumshrinksskinskincaresmoothsoapspecificallystartstoresupertargetsthingstooltypeusedusersvisibilityvisiblewashwidewinterworksworldzonezones
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Find the Best Skincare Products for Your Skin Type
H2 tags
Skincare world is confusing as hell.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 82
Failed: 3
Warnings: 0
Passed: 17
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 8.36 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 259 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 51.74 Kb to 8.36 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.66 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
63.0 %
484.17 Kb
javascript
20.5 %
157.87 Kb
font
12.4 %
95.50 Kb
css
4.0 %
30.52 Kb
html
0.1 %
716 B
other
0.0 %
0 B
TOTAL
100%
768.76 Kb
Requests by content type
Content type
Percent
Requests
image
41.7 %
5
font
33.3 %
4
html
8.3 %
1
css
8.3 %
1
javascript
8.3 %
1
other
0.0 %
0
TOTAL
100%
12
Content size by domain
Domain
Percent
Size
glow-demo.web.app
100.0 %
768.76 Kb
TOTAL
100%
768.76 Kb
Requests by domain
Domain
Percent
Requests
glow-demo.web.app
100.0 %
12
TOTAL
100%
12
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.109 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.109 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.539 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.539 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.86 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.86 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img alt="Skincare Advisor by Glow - Find the best skincare ..." src="/assets/logo-CQDDMjnh.png" style="height: clamp(40px, 15vw, 120px); width: auto;">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0000
Server and security
Score: 77
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "glow-demo.web.app" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
web.app
Subject Alternative Names (SANs)
web.app, *.web.app
Not valid before
Wed, June 25o 2025, 9:54:42 pm (z)
Not valid after
Tue, September 23o 2025, 9:54:41 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
WR4
Intermediate certificate
Common name
WR4
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31556926; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 58
Failed: 3
Warnings: 0
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved