seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://ganpatisevak.in/shabadimath-kannada-calendar-pdf-free-download
Your general SEO Checkup Score
Archived
71/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 71 out of 100, which is below the average score of 74. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
6 Warnings
49 Passed
Common SEO issues
Score: 75
Failed: 4
Warnings: 4
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 103 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Shabadimath Calendar 2023 Kannada PDF Download | ಶಬದಿಮಠ ಕನ್ನಡ 2023 ಕ್ಯಾಲೆಂಡರ್‌ Pdf 2023 – Ganpati Sevak
Length: 103 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 146 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Shabadimath calendar 2023 kannada PDF free download: Kannada holidays and festivals calendar 2023 January, February, March, April, May, June, July
Length: 146 characters
Google Search Results Preview Test
Desktop version
https://ganpatisevak.in/shabadimath-kannada-calendar-pdf-free-downloadShabadimath Calendar 2023 Kannada PDF Download | ಶಬದಿಮಠ ಕನ್ನಡ 2023 ಕ್ಯಾಲೆಂಡರ್‌ Pdf 2023 – Ganpati SevakShabadimath calendar 2023 kannada PDF free download: Kannada holidays and festivals calendar 2023 January, February, March, April, May, June, July
Mobile version
https://ganpatisevak.in/shabadimath-kannada-calendar-pdf-free-downloadShabadimath Calendar 2023 Kannada PDF Download | ಶಬದಿಮಠ ಕನ್ನಡ 2023 ಕ್ಯಾಲೆಂಡರ್‌ Pdf 2023 – Ganpati SevakShabadimath calendar 2023 kannada PDF free download: Kannada holidays and festivals calendar 2023 January, February, March, April, May, June, July
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
article
og:title
Shabadimath Calendar 2023 Kannada PDF Download | ಶಬದಿಮಠ ಕನ್ನಡ 2023 ಕ್ಯಾಲೆಂಡರ್‌ Pdf 2023
og:description
Shabadimath calendar 2023 kannada PDF free download: Kannada holidays and festivals calendar 2023 January, February, March, April, May, June, July
og:url
https://ganpatisevak.in/shabadimath-kannada-calendar-pdf-free-download/
og:site_name
Ganpati Sevak
og:image
https://ganpatisevak.in/wp-content/uploads/2021/12/Shabadimath-Kannada-Calendar-PDF-Download.jpg
og:image:width
450
og:image:height
250
og:image:type
image/jpeg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
100calendar50kannada49shabadimath46vrat43ganpati
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
calendar
kannada
shabadimath
vrat
ganpati
Keywords Cloud Test
aartiamavasyaangarikaaprilashtavinayakashtottaraatharvashirshaaugustbabababulalbappabengalibestcalendarchalisachaturthichaturvedicontentdarshandatedatesdecemberdecorationdownloadekadashiemailfebruaryfreeganeshganpatigoodgovernmentgovtgujaratihindihinduholidaysideasimagesindiainformationjanuaryjulyjunejyotirlingakannadakathalalbaugchalistlivelordmahalaxmimandirmantramarathimarchmarriagemithilamorningmuhuratnamesnovemberoctoberonlinepanchangphotospradoshprasadpublishedpujapurnimarajaringtoneringtonessangrandsankashtiseptembershabadimathshatanamavalishreeshrishubhsiddhivinayaksimplesiteskipsongsstatustelugutempletemplesthakurtimetithivideovidhivishnuvivahvratwhatsapp
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Shabadimath Calendar 2023 Kannada PDF Download | ಶಬದಿಮಠ ಕನ್ನಡ 2023 ಕ್ಯಾಲೆಂಡರ್‌ Pdf 2023
About Blog
Hindu Vrat Date & Fasting
Useful Link
Join Our Newsletter
H2 tags
Table of Contents
Shabadimath Calendar 2023 Kannada PDF Free Download
Shabadimath Kannada Calendar 2023 January
Shabadimath Kannada Calendar 2023 February
Shabadimath Kannada Calendar 2023 March
Shabadimath Kannada Calendar 2023 April
Shabadimath Kannada Calendar 2023 May
Shabadimath Kannada Calendar 2023 June
Shabadimath Kannada Calendar 2023 July
Shabadimath Kannada Calendar 2023 August
Shabadimath Kannada Calendar 2023 September
Shabadimath Kannada Calendar 2023 October
Shabadimath Kannada Calendar 2023 November
Shabadimath Kannada Calendar 2023 December
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
2center
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 51
Failed: 9
Warnings: 1
Passed: 13
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 8,105 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 320.02 Kb to 54.71 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 7.96 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
32.9 %
1.38 Mb
image
32.6 %
1.36 Mb
font
12.7 %
542.24 Kb
other
9.7 %
415.26 Kb
html
9.4 %
402.73 Kb
css
2.7 %
117.14 Kb
TOTAL
100%
4.18 Mb
Requests by content type
Content type
Percent
Requests
other
39.5 %
230
image
22.7 %
132
javascript
16.5 %
96
html
12.5 %
73
css
5.8 %
34
font
2.9 %
17
TOTAL
100%
582
Content size by domain
Domain
Percent
Size
ganpatisevak.in
39.1 %
1.64 Mb
cds.connatix.com
10.1 %
432.53 Kb
securepubads.g.doubleclick.net
9.2 %
393.58 Kb
imasdk.googleapis.com
8.1 %
345.88 Kb
fonts.gstatic.com
6.7 %
284.71 Kb
tpc.googlesyndication.com
6.3 %
270.58 Kb
capi.connatix.com
2.9 %
124.74 Kb
cdn.ampproject.org
2.6 %
109.51 Kb
go.ezodn.com
2.2 %
93.31 Kb
g.ezoic.net
1.3 %
54.87 Kb
Other
11.6 %
494.40 Kb
TOTAL
100%
4.18 Mb
Requests by domain
Domain
Percent
Requests
g.ezoic.net
15.6 %
91
ganpatisevak.in
11.7 %
68
securepubads.g.doubleclick.net
8.4 %
49
tpc.googlesyndication.com
3.8 %
22
prebid.a-mo.net
3.6 %
21
capi-tier-1-us-east-2.connatix.com
3.4 %
20
google.com
2.9 %
17
simage2.pubmatic.com
2.7 %
16
fonts.gstatic.com
2.2 %
13
pagead2.googlesyndication.com
2.2 %
13
Other
43.3 %
252
TOTAL
100%
582
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 5.86 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.86 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img width="450" height="250" src="https://ganpatisevak.in/wp-content/uploads/2021/12..." class="attachment-large size-large wp-image-3648" alt="Shabadimath Calendar 2023 Kannada PDF Free Downloa..." loading="lazy" srcset="https://ganpatisevak.in/wp-content/uploads/2021/12..." sizes="(max-width: 450px) 100vw, 450px">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.027. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0272

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Sankashti Chaturthi Dates 2023
Html: <a href="https://ganpatisevak.in/sankashti-chaturthi-dates-..." class="elementor-item">
Score: 0.0119
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "ganpatisevak.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.ganpatisevak.in
Subject Alternative Names (SANs)
*.ganpatisevak.in, ganpatisevak.in
Not valid before
Fri, December 2o 2022, 11:58:40 am (z)
Not valid after
Thu, March 2o 2023, 11:58:39 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS CA 1P5
Intermediate certificate
Common name
GTS CA 1P5
Organization
Google Trust Services LLC
Location
US
Not valid before
Thu, August 13o 2020, 12:00:42 am (z)
Not valid after
Thu, September 30o 2027, 12:00:42 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://ganpatisevak.in/shabadimath-kannada-calendar-pdf-free-download is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://ganpatisevak.in/shabadimath-kannada-calendar-pdf-free-download/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but it contains duplicated or invalid records! These warnings highlight points of concern which should not affect the processing of the authorized sellers list, but which should be resolved as soon as possible.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved