seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://firexcore.com/blog/dnsbomb-dos-attack-a-new-challenge-for-network-security
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 102 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
4 Warnings
57 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 72
Failed: 4
Warnings: 2
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 68 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: DNSBomb DoS Attack: A New Challenge for Network Security - FireXCore
Length: 68 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 250 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Discover the latest threat to internet infrastructure with the DNSBomb DoS attack. Learn how DNS queries and responses are exploited in this powerful cybersecurity threat, and what measures are being taken to mitigate it. Stay updated with FireXCore.
Length: 250 characters
Google Search Results Preview Test
Desktop version
https://firexcore.com/blog/dnsbomb-dos-attack-a-new-challenge-for-network-security/DNSBomb DoS Attack: A New Challenge for Network Security - FireXCoreDiscover the latest threat to internet infrastructure with the DNSBomb DoS attack. Learn how DNS queries and responses are exploited in this powerful cybersecurity threat, and what measures are being taken to mitigate it. Stay updated with FireXCore.
Mobile version
https://firexcore.com/blog/dnsbomb-dos-attack-a-new-challenge-for-network-security/DNSBomb DoS Attack: A New Challenge for Network Security - FireXCoreDiscover the latest threat to internet infrastructure with the DNSBomb DoS attack. Learn how DNS queries and responses are exploited in this powerful cybersecurity threat, and what measures are being taken to mitigate it. Stay updated with FireXCore.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
article
og:title
DNSBomb DoS Attack: A New Challenge for Network Security - FireXCore
og:description
Discover the latest threat to internet infrastructure with the DNSBomb DoS attack. Learn how DNS queries and responses are exploited in this powerful cybersecurity threat, and what measures are being taken to mitigate it. Stay updated with FireXCore.
og:url
https://firexcore.com/blog/dnsbomb-dos-attack-a-new-challenge-for-network-security/
og:site_name
FireXCore
og:updated_time
2024-07-03T16:11:32+04:00
og:image
https://firexcore.com/wp-content/uploads/2024/05/DNSBomb-1-300x164.webp
og:image:secure_url
https://firexcore.com/wp-content/uploads/2024/05/DNSBomb-1.webp
og:image:width
1024
og:image:height
560
og:image:alt
DNSBomb DoS Attack
og:image:type
image/webp
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
23dnsbomb17attack9software7have7infrastructure
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
dnsbomb
attack
software
have
infrastructure
Keywords Cloud Test
aheadaimedalarmingamplificationamplifyanalysisartificialattackattacksbandwidthblogcausingcybercybersecurityddosdenialdevelopmentdisruptiondnsbombdomaineffectiveevaluationsexperimentsexploitedfactorfindingsfirexcoregbpshavehighincidentindustryinformedinfrastructureintelligenceinternetjulyknotlatestleveragesmeasuresmitigationmodernmodifiedmonitoringnetworknewsletterorganizationspacketpatchespeakpotentpotentialpowerfulpreviouspriceproactiveproposedprotectpulsepulsingregularreleasedreportedrequestsresearchersresolversresponseresponsesscalesecuritysendingserversserviceservicesseveresignificantsizeslowsmallsoftwaresolutionsstaystrategiestargettechniquetestedthreatthreatstimestrickletsinghuauniversityupdatedupdatesusingvendorsvolumevulnerabilitieswithhold
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
DNSBomb DoS Attack: A New Challenge for Network Security
H2 tags
Understanding DNSBomb: A Modern Twist on a Classic Technique
FAQ
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 87
Failed: 3
Warnings: 2
Passed: 15
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 17.02 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 379 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 84.03 Kb to 17.02 Kb (80% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.94 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
font
42.7 %
171.09 Kb
image
30.8 %
123.48 Kb
css
20.7 %
83.11 Kb
html
4.3 %
17.13 Kb
javascript
1.4 %
5.46 Kb
other
0.2 %
857 B
TOTAL
100%
401.11 Kb
Requests by content type
Content type
Percent
Requests
css
34.6 %
9
image
30.8 %
8
font
19.2 %
5
javascript
7.7 %
2
html
3.8 %
1
other
3.8 %
1
TOTAL
100%
26
Content size by domain
Domain
Percent
Size
firexcore.com
84.9 %
340.50 Kb
fonts.gstatic.com
14.8 %
59.34 Kb
fonts.googleapis.com
0.3 %
1.27 Kb
TOTAL
100%
401.11 Kb
Requests by domain
Domain
Percent
Requests
firexcore.com
80.8 %
21
fonts.gstatic.com
15.4 %
4
fonts.googleapis.com
3.8 %
1
TOTAL
100%
26
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.116 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.116 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.746 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.746 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.25 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.25 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img width="1024" height="560" src="https://firexcore.com/wp-content/uploads/2024/05/D..." class="img-fluid wp-post-image entered lazyloaded" alt="DNSBomb DoS Attack" decoding="async" fetchpriority="high" title="DNSBomb DoS Attack: A New Challenge for Network Se..." data-lazy-src="https://firexcore.com/wp-content/uploads/2024/05/D..." data-ll-status="loaded">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0576. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0576

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Cybersecurity researchers at Tsinghua University have unveiled a groundbreaking ...
Html: <div class="article-content">
Score: 0.0537
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 6
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "firexcore.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
kimavi.ir.hcbrandco.com
Subject Alternative Names (SANs)
*.com.hcbrandco.com, *.firexcore.com, *.kimavi.ir, cpanel.hcbrandco.com, cpcalendars.hcbrandco.com, cpcontacts.hcbrandco.com, firexcore.com, hcbrandco.com, kimavi.ir, kimavi.ir.hcbrandco.com, mail.hcbrandco.com, webdisk.hcbrandco.com, webmail.hcbrandco.com, www.firexcore.com.hcbrandco.com, www.hcbrandco.com, www.kimavi.ir.hcbrandco.com
Not valid before
Mon, July 8o 2024, 2:11:59 pm (z)
Not valid after
Sun, October 6o 2024, 2:11:58 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 1
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
<link href="https://firexcore.com/blog/dnsbomb-dos-attack-a-new-challenge-for-network-security/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:174.136.57.49 +a +mx +ip4:78.142.63.250 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved