seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://filmy5wep.wap.sh
Your general SEO Checkup Score
Archived
63/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 63 out of 100, which is below the average score of 74. However, there are 20 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
20 Failed
5 Warnings
47 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
To implement responsive design functionalities, it is recommended to use CSS media queries.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 48
Failed: 9
Warnings: 3
Passed: 14
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 82 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Filmy5wep filmy4web in filmy4wap xyz filmy4wap 2023 All Movie Download Links Store
Length: 82 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 235 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Filmy5wep | filmy4web in | filmy4wap xyz | filmy4wap 2023 | Bollywood Movies | South Indian Hindi Dubbed Movies | Hollywood Hindi Dubbed Movies | Hollywood Bengali Dubbed Movies | Web Series HD | Indian TV Shows | Indian Hot Short Film
Length: 235 characters
Google Search Results Preview Test
Desktop version
https://filmy5wep.wap.sh/Filmy5wep filmy4web in filmy4wap xyz filmy4wap 2023 All Movie Download Links StoreFilmy5wep | filmy4web in | filmy4wap xyz | filmy4wap 2023 | Bollywood Movies | South Indian Hindi Dubbed Movies | Hollywood Hindi Dubbed Movies | Hollywood Bengali Dubbed Movies | Web Series HD | Indian TV Shows | Indian Hot Short Film
Mobile version
https://filmy5wep.wap.sh/Filmy5wep filmy4web in filmy4wap xyz filmy4wap 2023 All Movie Download Links StoreFilmy5wep | filmy4web in | filmy4wap xyz | filmy4wap 2023 | Bollywood Movies | South Indian Hindi Dubbed Movies | Hollywood Hindi Dubbed Movies | Hollywood Bengali Dubbed Movies | Web Series HD | Indian TV Shows | Indian Hot Short Film
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:url
https://filmy5wep.wap.sh/
og:title
Filmy5wep filmy4wap in filmy4wap xyz filmy4wap pro All Movie Download Links Store
og:description
Filmy5wep | filmy4web in | filmy4wap xyz | filmy4wap 2023 | Bollywood Movies | South Indian Hindi Dubbed Movies | Hollywood Hindi Dubbed Movies | Hollywood Bengali Dubbed Movies | Web Series HD | Indian TV Shows | Indian Hot Short Film
og:image
https://filmy5wep.wap.sh/filmy5wep.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
11movies11movie6indian6dubbed5filmyfly
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
movies
movie
indian
dubbed
filmyfly
Keywords Cloud Test
adipurushantimbachkebengaliboatbollywoodbookmarkcontactcoolmoviezdmcadubbedeasyfilmfilmyflyfilmywapfilmyzillagujaratihatkeheropantihindihollywoodhomehotmailhttpsindianjhoothilatestlinkmainmakkaarmewebmoviemoviemadmoviesmoviesflixmoviespapapathanpolicyprivacyqueryringseriesservicesshamsherashehzadashortshowssouthspecialstorytagstigertimetodaytotaltrendingupdatevedhavikramwikixyzvyaariyanzara
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Filmy5wep Trending Movies
Filmy5wep Latest Movies Update
Filmy5wep Special Services
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
2center
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 80
Failed: 4
Warnings: 1
Passed: 18
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 4.68 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 356 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 21.57 Kb to 4.68 Kb (78% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.24 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
98.7 %
2.42 Mb
html
0.7 %
17.36 Kb
javascript
0.4 %
9.82 Kb
css
0.2 %
4.59 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
2.45 Mb
Requests by content type
Content type
Percent
Requests
image
75.0 %
18
html
8.3 %
2
css
8.3 %
2
javascript
8.3 %
2
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
24
Content size by domain
Domain
Percent
Size
filmy5wep.wap.sh
99.5 %
2.44 Mb
secure.quantserve.com
0.4 %
9.19 Kb
4.thumbs.xtstatic.com
0.0 %
1.23 Kb
xtgem.com
0.0 %
843 B
rules.quantcount.com
0.0 %
642 B
pixel.quantserve.com
0.0 %
455 B
enif.images.xtstatic.com
0.0 %
309 B
cif.images.xtstatic.com
0.0 %
309 B
TOTAL
100%
2.45 Mb
Requests by domain
Domain
Percent
Requests
filmy5wep.wap.sh
70.8 %
17
4.thumbs.xtstatic.com
4.2 %
1
enif.images.xtstatic.com
4.2 %
1
cif.images.xtstatic.com
4.2 %
1
secure.quantserve.com
4.2 %
1
xtgem.com
4.2 %
1
rules.quantcount.com
4.2 %
1
pixel.quantserve.com
4.2 %
1
TOTAL
100%
24
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.1 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.1 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://filmy5wep.wap.sh/hindi/Tu+Jhoothi+Main+Mak..." alt="">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.017. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0166

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Bookmark Now https://filmy5wep.wap.sh Filmy5wep Trending Movies Filmy5wep Latest...
Html: <div id="mainDiv">
Score: 0.0146
Server and security
Score: 59
Failed: 4
Warnings: 0
Passed: 6
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "filmy5wep.wap.sh" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.wap.sh
Subject Alternative Names (SANs)
*.wap.sh, wap.sh
Not valid before
Tue, May 23o 2023, 9:17:10 am (z)
Not valid after
Mon, August 21o 2023, 9:17:09 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is not using CSS media queries. We recommend the use of this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved