seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://filepdf.org
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
2 Warnings
57 Passed
Common SEO issues
Score: 75
Failed: 4
Warnings: 1
Passed: 20
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: FILEPDF PH - platform ng pagse-share ng dokumento
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: 5.000.000++ dokumento kasama ang thesis, mga libre, papeles, mga form, pdf, doc, docx, ppt, pptx,… mga online na dokumento mula sa lahat ng larangan.
Google Search Results Preview Test
Desktop version
https://filepdf.orgFILEPDF PH - platform ng pagse-share ng dokumento5.000.000++ dokumento kasama ang thesis, mga libre, papeles, mga form, pdf, doc, docx, ppt, pptx,… mga online na dokumento mula sa lahat ng larangan.
Mobile version
https://filepdf.orgFILEPDF PH - platform ng pagse-share ng dokumento5.000.000++ dokumento kasama ang thesis, mga libre, papeles, mga form, pdf, doc, docx, ppt, pptx,… mga online na dokumento mula sa lahat ng larangan.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
FILEPDF PH - platform ng pagse-share ng dokumento
og:description
5.000.000++ dokumento kasama ang thesis, mga libre, papeles, mga form, pdf, doc, docx, ppt, pptx,… mga online na dokumento mula sa lahat ng larangan.
og:url
https://filepdf.org
og:type
article
og:image
assets/frontend/images/doc_normal.png
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
10study9role8rural5implications5design
Keywords Usage Test81% of top 100 sites passed
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
actsaminganalyzeattitudebaptistbigyancasechristianitychurchcityconductedconventioncurrentdesigndeterminedevelopdevelopingdiakonosdigitaldokumentodutiesenergizedenhancfindingsgrowthguimarashavehealthhospitalhumaniloiloimplementationimplicationsinfointegrationinteractionsinterdependenceislamiyongkaalamankapangyarihankarenknowledgeloadingmabilismahanapmakakuhamanagementmemorialmissionmyanmarnangungunangayongpagkakataongpalawakinpamamagitanpananaliksikpaperperceivedphilippinepolicypresentprincipalspromotionprototypeprovinceprovincialpublicregistrationrekomendasyonrelationshipresearchresourcerobocarrobotrolerolesroxasruralsagotsalientsecurityseriessistemaskillssocietyspecificallystatusstepstudentsstudytechnologytermstestingthirtyurbanwifiworkworkersworking
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Ang Kaalaman ay kapangyarihan
H2 tags
Mga paksa sa browser
Mga sikat na dokumento
Salient findings (Info. series 12-02)
Salient findings (Info. series 11-04)
Salient findings (Info. series 11-03)
Rural-urban interactions and interdependence: Policy implications for the enhanc...
The rural mission work of the Karen Baptist Convention in Myanmar
Rural land registration in Inner Mongolia of China: Status, perceptions and inte...
Rural electrification: Its effects on people's socioeconomic life and aspiration...
Roxas Memorial Provincial Hospital human resource management system
The roles of public health workers in the promotion and implementation of mass d...
The role of the Holy Spirit in church growth (A descriptive and exegetical paper...
The role of the Church on the present Philippine society
The role of elementary school principals as perceived by principals, teachers, t...
The role of digital technology in reinforcing deviant sexual behavior: Nine case...
The role of diakonos in Acts 6: 1-8 and its implications to the current understa...
Roboguard: A research on the integration of WiFi in security robots using PDA as...
Robocar: Design implementation and testing of a robot car
RLE skills: Its relationship to knowledge, attitude and perceived adequacy of BS...
Rizal Buenavista Yacht Makers Assn., Inc.: A case study on its growth and develo...
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • All images in this page are properly sized for different users' viewports.
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 88
Failed: 2
Warnings: 1
Passed: 19
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,143 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 287.17 Kb to 75.45 Kb (74% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 1.77 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Content size by content type
Content type
Percent
Size
javascript
57.5 %
123.59 Kb
html
41.0 %
88.07 Kb
image
1.4 %
3.10 Kb
other
0.1 %
303 B
css
0.0 %
0 B
font
0.0 %
0 B
TOTAL
100%
215.05 Kb
Requests by content type
Content type
Percent
Requests
javascript
50.0 %
3
html
16.7 %
1
image
16.7 %
1
other
16.7 %
1
css
0.0 %
0
font
0.0 %
0
TOTAL
100%
6
Content size by domain
Domain
Percent
Size
filepdf.org
63.7 %
136.91 Kb
googletagmanager.com
33.3 %
71.72 Kb
asset-filepdf-org.123doks.com
2.8 %
6.12 Kb
google-analytics.com
0.1 %
303 B
TOTAL
100%
215.05 Kb
Requests by domain
Domain
Percent
Requests
filepdf.org
33.3 %
2
asset-filepdf-org.123doks.com
33.3 %
2
googletagmanager.com
16.7 %
1
google-analytics.com
16.7 %
1
TOTAL
100%
6
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Caching Test99% of top 100 sites passed
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Your webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 1.56 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.56 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Ang Kaalaman ay kapangyarihan
Html: <h1 class="title-font lg:text-6xl sm:text-5xl text-4xl leadin...">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 77
Failed: 2
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "filepdf.org" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
filepdf.org
Subject Alternative Names (SANs)
filepdf.org, www.filepdf.org
Not valid before
Wed, July 6o 2022, 12:00:00 am (z)
Not valid after
Sun, August 6o 2023, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
Server: nginx/1.14.1
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://filepdf.org is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://filepdf.org" rel="canonical"/>
Nofollow Tag Test
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:spf.efwd.registrar-servers.com ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved