seo site checkup logo
PricingFree ToolsArticles
Report generated 8 months ago
https://fapleaks.42web.io/fapleaks/one
Your general SEO Checkup Score
Archived
59/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 59 out of 100, which is below the average score of 75. However, there are 20 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
20 Failed
6 Warnings
48 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
LOW
While a canonical link tag can help in resolving duplicate content issues, it's important to verify that the specified URL is accurate, especially if the site's URL structure has been recently updated.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 39
Failed: 9
Warnings: 1
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 10 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Fapleaks -
Length: 10 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://fapleaks.42web.io/fapleaks/one/?i=1Fapleaks -
Mobile version
https://fapleaks.42web.io/fapleaks/one/?i=1Fapleaks -
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Fapleaks
og:url
https://fapleaks.42web.io/fapleaks/one/
og:site_name
Fapleaks
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
13girl8naked7twerking6password5panties
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
girl
naked
twerking
password
panties
Keywords Cloud Test
accountactorsanalblondcontentdancedildodmcaemailenterfapleaksgirlhavehomejoinlatestlatinalinklivestreamloadingloginlostmailnakedpantiespasswordplugpolicypopularprivacyprofileresetsentsignskipskirttagstermstwerktwerkingusedusernamevideos
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Latest videos
Popular videos
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test8% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 66
Failed: 5
Warnings: 5
Passed: 15
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 9.02 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 432 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 52.44 Kb to 9.02 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.12 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
92.2 %
2.22 Mb
other
3.1 %
75.63 Kb
javascript
3.0 %
72.99 Kb
css
1.4 %
34.11 Kb
html
0.4 %
9.25 Kb
font
0.0 %
0 B
TOTAL
100%
2.41 Mb
Requests by content type
Content type
Percent
Requests
image
48.6 %
17
javascript
34.3 %
12
css
8.6 %
3
html
5.7 %
2
other
2.9 %
1
font
0.0 %
0
TOTAL
100%
35
Content size by domain
Domain
Percent
Size
fapleaks.42web.io
100.0 %
2.41 Mb
TOTAL
100%
2.41 Mb
Requests by domain
Domain
Percent
Requests
fapleaks.42web.io
100.0 %
35
TOTAL
100%
35
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using cache headers for all JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 1.689 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

1.689 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.424 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.424 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.61 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.61 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img data-src="https://fapleaks.42web.io/fapleaks/one/wp-content/..." alt="Girl twerking with anal plug" class="loaded" src="https://fapleaks.42web.io/fapleaks/one/wp-content/..." data-was-processed="true">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0005. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0005

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Actors
Html: <a href="https://fapleaks.42web.io/fapleaks/one/actors/">
Score: 0.0005
Server and security
Score: 66
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "fapleaks.42web.io" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
fapleaks.42web.io
Subject Alternative Names (SANs)
fapleaks.42web.io, *.fapleaks.42web.io
Not valid before
Fri, September 6o 2024, 6:20:15 pm (z)
Not valid after
Thu, December 5o 2024, 6:20:14 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
WR1
Intermediate certificate
Common name
WR1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 77
Failed: 3
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://fapleaks.42web.io/fapleaks/one/ should be the preferred version of this page. The canonical tag can be useful when there are similar versions of the same content on several URLs (e.g., such as e-commerce sites where URL modifiers like sort parameters are appended to a product page's URL). Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://fapleaks.42web.io/fapleaks/one/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved