seo site checkup logo
PricingFree ToolsArticles
Report generated 3 hours ago
https://faithandfamilyfilms.net
Your general SEO Checkup Score
Archived
72/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 72 out of 100, which is below the average score of 75. However, there are 14 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
14 Failed
3 Warnings
44 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
LOW
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 78
Failed: 4
Warnings: 0
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Faith & Family Flicks - Two Pastors, Popcorn and a Movie
Length: 56 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Two Pastors, Popcorn and a Movie explores faith and family through the world of film. Find Christian movie reviews, family-friendly film insights, and uplifting conversations that inspire, strengthen values.
Length: 207 characters
Google Search Results Preview Test
Desktop version
https://faithandfamilyfilms.net/Faith & Family Flicks - Two Pastors, Popcorn and a MovieTwo Pastors, Popcorn and a Movie explores faith and family through the world of film. Find Christian movie reviews, family-friendly film insights, and uplifting conversations that inspire, strengthen values.
Mobile version
https://faithandfamilyfilms.net/Faith & Family Flicks - Two Pastors, Popcorn and a MovieTwo Pastors, Popcorn and a Movie explores faith and family through the world of film. Find Christian movie reviews, family-friendly film insights, and uplifting conversations that inspire, strengthen values.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:url
https://faithandfamilyfilms.net/
og:site_name
Faith and Family Flicks
og:image
https://storage.googleapis.com/gpt-engineer-file-uploads/jWHNkjkWHLftmn14zye7uIjyOCa2/social-images/social-1768963961506-ogimage-fff.png
og:title
Faith & Family Flicks
og:description
Two Pastors, Popcorn and a Movie explores faith and family through the world of film. Find Christian movie reviews, family-friendly film insights, and uplifting conversations that inspire, strengthen values.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
57movie19family17david16inspirational15chosen
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
movie
family
david
inspirational
chosen
Keywords Cloud Test
actionadventureamericanangelsanimatedaudiencebestblogbluebrandonbreakthroughcampcarpetchosenchristianchristmaschurchcodecomedyconnerdaviddisciplesdiscountdocumentarydramafaithfamilyfionaflyntfootballforgegamegoldgrowshistoricalhistoryhoffmanhomehonghopeimagineinspirationalinterviewislandjamesjesuskarenkevinkingkingskingsburylakelifelivemercymikemiraclemoonlightmoviemoviesmusicpageantpastorpastorsphilpodcastpopcornpureflixreactionsreaganresourcesreviewreviewsreviverevolutionringrowesaveseasonseniorseriesshipshipsshortslidesnowsoulstorystrangertakesticketstrailertreasontruetruthunbreakableunderdogwatchwoodlawnworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Trailers
Two Pastors, Popcorn and a Movie Podcast
Sharing Movies Worthy Podcast
Red Carpet Events
Live
Shorts
Our Sponsors
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 67
Failed: 7
Warnings: 1
Passed: 12
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 17.96 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,840 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 226.9 Kb to 17.96 Kb (92% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.92 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
92.6 %
55.77 Mb
other
6.8 %
4.06 Mb
javascript
0.6 %
358.72 Kb
css
0.0 %
12.66 Kb
html
0.0 %
2.17 Kb
font
0.0 %
0 B
TOTAL
100%
60.20 Mb
Requests by content type
Content type
Percent
Requests
image
87.5 %
126
other
9.0 %
13
javascript
2.1 %
3
html
0.7 %
1
css
0.7 %
1
font
0.0 %
0
TOTAL
100%
144
Content size by domain
Domain
Percent
Size
faith-family-films.s3.us-east-2.amazonaws.com
94.1 %
56.66 Mb
faith-family-films.s3.amazonaws.com
3.0 %
1.82 Mb
faithandfamilyfilms.net
2.5 %
1.53 Mb
googletagmanager.com
0.2 %
145.00 Kb
faithandfamilyfilms.mediawve.com
0.1 %
42.30 Kb
faithandfamilyfilms.s3.amazonaws.com
0.0 %
596 B
TOTAL
100%
60.20 Mb
Requests by domain
Domain
Percent
Requests
faith-family-films.s3.us-east-2.amazonaws.com
81.3 %
117
faithandfamilyfilms.net
11.1 %
16
faithandfamilyfilms.mediawve.com
3.5 %
5
faith-family-films.s3.amazonaws.com
2.8 %
4
googletagmanager.com
0.7 %
1
faithandfamilyfilms.s3.amazonaws.com
0.7 %
1
TOTAL
100%
144
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
See results list
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for all JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.477 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.477 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.696 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.696 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.9 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.9 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="absolute inset-0 bg-cover bg-center bg-no-repeat" style="background-image: url("/assets/standing-against-wo...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0004. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0004

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Home Movies Series Resources Blog
Html: <nav class="flex items-center space-x-6">
Score: 0.0004
Server and security
Score: 68
Failed: 1
Warnings: 1
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "faithandfamilyfilms.net" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
faithandfamilyfilms.net
Subject Alternative Names (SANs)
faithandfamilyfilms.net
Not valid before
Sat, December 20o 2025, 8:53:27 pm (z)
Not valid after
Fri, March 20o 2026, 9:53:22 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Root certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://faithandfamilyfilms.net/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://faithandfamilyfilms.net/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved