seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://fairtraderoute.nl
Your general SEO Checkup Score
Archived
53/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 53 out of 100, which is below the average score of 75. However, there are 15 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
15 Failed
2 Warnings
22 Passed
Common SEO issues
Score: 64
Failed: 4
Warnings: 1
Passed: 10
Google Search Results Preview
Desktop version
http://fairtraderoute.nl/Fairtrade webshops, winkels, merken en producten vinden.Fairtraderoute heeft een selectie gemaakt van regelmatig wisselende fairtrade webshops, winkels, merken en producten.
Mobile version
http://fairtraderoute.nl/Fairtrade webshops, winkels, merken en producten vinden.Fairtraderoute heeft een selectie gemaakt van regelmatig wisselende fairtrade webshops, winkels, merken en producten.
Keywords Cloud
accessoiresafmetingafrikaanseallebabybijzonderebiologischbodylotionbuttercanvascrèmedaardagendezedoordrogeduurzameeigenschappenenergieextrafairfairtradefeelgeborsteldegebruiktgeeftgeengeldgemaaktgespletengevoeligegezichtgloriegoedhaarmaskerhaarpuntenhebbenheefthierhuidhuisinfoinfo@teakea.nljasmijnkarakterkettingkleurkleurstellinglandelijklevertijdlichaamlippenlookmaarmaatmassiefmateriaalmeermerkenmeubelenmeubelsmodenagelsnatuurlijkenietovernachtingpluginproductenqueensheasiteteakhoutentoplaagtradetradetrackertuinuitstralingurtekramverderverfverganeverzachtverzendkostenverzorgendevochtarmevoedendevoorvrouwenwebshopswerkdagenwinkelswittewonenwoonseriewordenwordpresszeggenzelfszichtzijn
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
SEO Friendly URL Test
  • This analyzed URL is SEO friendly but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 91 'img' tags and 6 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 189 inline CSS styles!
See results list
Deprecated HTML Tags
  • We found some HTML deprecated tags. Your are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • Your site either does't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulation! There is no occurrence of any severe JavaScript Errors in your web page.
Social Media Check
Speed optimizations
Score: 14
Failed: 7
Warnings: 1
Passed: 2
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 91 % - from 633.49 Kb to 54.52 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 79.852 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 204
  • 29 HTML Pages
  • 12 CSS Files
  • 37 JS Files
  • 125 Images
  • 1 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and jpcache. Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Warning: your website contains flash objects. Flash is an outdated technology that is used to deliver rich multimedia content. Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
See results list
Image Caching Test
  • Your site is not using expires headers for all of your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • It appears that your site contains nested tables. Nested tables can be slow to render in some browsers. Consider using a CSS layout to reduce both HTML size and page loading time.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html PUBLIC &quot;-//W3C//DTD XHTML 1.0 Transitional//EN&quot; &quot;http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd&quot;>
Server and security
Score: 66
Failed: 3
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.2.16 (Debian)
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 63
Failed: 1
Warnings: 0
Passed: 4
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://fairtraderoute.nl/" />
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved