seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://fabricpatch.com.au/main
Your general SEO Checkup Score
Archived
84/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 84 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
1 Warnings
31 Passed
Common SEO issues
Score: 80
Failed: 3
Warnings: 1
Passed: 11
Google Search Results Preview
Desktop version
http://fabricpatch.com.au/main/Fabric Patch: Patchwork Quilting fabrics, Moda fabric, Quilt Supplies,�PatternsFabric Patch: SECONDARY_SECTIONFabric Honeybun/Sweet Roll Fabric by Range Patterns Free Patterns Books Jelly Rolls Charm squares Fat Quarter & 1/2 Yard Bundles Layer Cakes Quilt Kits/Bag Kits/Softie Kits Felt Rasant Threads Batting/Vilene Iron On Fabric Labels Lunch Box Bag Kits Ric Rac Gift Vouchers Bias Binding Cutters, Blades - Olfa & Others Pom Pom Trim Creative Grids Rulers Mini Charm Squares Dessert Rolls Modkid Designer Pins Venise Lace Daisy, 1 inch Honeycombs Clover Needles, Pins, Bobbins & Bits Scissors & Cutting Accessories Q Snap Frames Sewline Products Fat Eighth Bundle Add Shipping Options Other Pens, Pencils Papers Other Rulers & Grids Fabric - Spots, Stripes or Check Mirah Batiks Apliquick Tools Adhesives, Glues & Sprays End of Bolts Loan of Bella Solids Colour Card Christmas Fabrics Bag Making Accessories Embroidery & Perle Threads United Stitches Current Fabric Specials Frivols Monthly Subscriptions Lay-By Gift Wrapping Toy Fill Gutermann Quilting Thread Template Plastic Tilda Webbing Crochet Flowers, Embelishments Early Precuts & New Arrivals Purse Frames Seams Sew Easy Theodora Cleave Moda Scrap Bags Aurifil Threads Cotton Piping Cord Sue Daley Notions Homespun BOM 2016 Program FREE Quilt Patterns, Online Discount Store, Patchwork quilting fabric, Moda fabrics, Jelly rolls, Layer cakes, Charm squares
Mobile version
http://fabricpatch.com.au/main/Fabric Patch: Patchwork Quilting fabrics, Moda fabric, Quilt Supplies,�PatternsFabric Patch: SECONDARY_SECTIONFabric Honeybun/Sweet Roll Fabric by Range Patterns Free Patterns Books Jelly Rolls Charm squares Fat Quarter & 1/2 Yard Bundles Layer Cakes Quilt Kits/Bag Kits/Softie Kits Felt Rasant Threads Batting/Vilene Iron On Fabric Labels Lunch Box Bag Kits Ric Rac Gift Vouchers Bias Binding Cutters, Blades - Olfa & Others Pom Pom Trim Creative Grids Rulers Mini Charm Squares Dessert Rolls Modkid Designer Pins Venise Lace Daisy, 1 inch Honeycombs Clover Needles, Pins, Bobbins & Bits Scissors & Cutting Accessories Q Snap Frames Sewline Products Fat Eighth Bundle Add Shipping Options Other Pens, Pencils Papers Other Rulers & Grids Fabric - Spots, Stripes or Check Mirah Batiks Apliquick Tools Adhesives, Glues & Sprays End of Bolts Loan of Bella Solids Colour Card Christmas Fabrics Bag Making Accessories Embroidery & Perle Threads United Stitches Current Fabric Specials Frivols Monthly Subscriptions Lay-By Gift Wrapping Toy Fill Gutermann Quilting Thread Template Plastic Tilda Webbing Crochet Flowers, Embelishments Early Precuts & New Arrivals Purse Frames Seams Sew Easy Theodora Cleave Moda Scrap Bags Aurifil Threads Cotton Piping Cord Sue Daley Notions Homespun BOM 2016 Program FREE Quilt Patterns, Online Discount Store, Patchwork quilting fabric, Moda fabrics, Jelly rolls, Layer cakes, Charm squares
Keywords Cloud
accessoriesapliquickarrivalsaustraliabebebladesblakeblossombooksbundlebunnycardcardscartcharmchristmasclothingclovercottoncreativecreditcutterscuttingdeardesidesigndesignerdesignsdewberrydressearlyeasterembroideryfabricfabricsfeaturedframesfreegiftgiveawaysgridshomeincludingjellyjoelkitsladieslatestlaybylayerlecienliberatedmakingmichaelmillermodamodkidnewsletterolfapaperspatchpatchworkpatternpatternspaymentpaymentspaypalperlepinsplasticprecutsprivacyproductspursequarterquickquiltquiltingquinlanrangereversiblerileyrollrollsrosalierulersscissorssewingsewlineshippingshoppingsignupsnapspecialssquarestemplatethreadsvoucherswebbingwrap
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • Congratulations! This URL and all internal links on this page are SEO friendly.
Image Alt Test
  • Your webpage has 96 'img' tags and 12 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 42 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the correct version of Google Analytics tracking code.
Favicon Test
  • We've found a favicon in your page's HTML code, but it's not accessible.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using: Facebook; Twitter;
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 9
HTML Page Size Test
  • Congratulations! Your HTML size is 12.36 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 80.14 Kb to 12.36 Kb (85 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 1.795 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 121
  • 3 HTML Pages
  • 6 CSS Files
  • 1 JS Files
  • 111 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html PUBLIC &quot;-//W3C//DTD XHTML 1.0 Transitional//EN&quot; &quot;http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd&quot;>
Server and security
Score: 66
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 +a +mx +ip4:173.192.165.196 ?all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved