seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://evawomenshospital.com
Your general SEO Checkup Score
Archived
78/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 78 out of 100, which is higher than the average score of 74. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
6 Warnings
51 Passed
Issues to fix
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Keep in mind that the NOINDEX meta tag instructs search engines not to index a webpage. Please verify if this is the intended behavior, as the webpage will not appear in search engine results.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 73
Failed: 5
Warnings: 3
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 135 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Women's Hospital Ahmedabad, Best Gynaecologist in Gujarat, Best Endometriosis treatment in Gujarat, Hysterectomy Doctors/Surgery at EVA
Length: 135 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 225 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Eva Women's Hospital in Ahmedabad is committed to provide quality treatment by best Gynaecologist in Gujarat. Get Hysterectomy Surgery in Ahmedabad by Doctors at Eva Hospital. We offer best endometriosis treatment in Gujarat.
Length: 225 characters
Google Search Results Preview Test
Desktop version
https://www.evawomenshospital.com/Women's Hospital Ahmedabad, Best Gynaecologist in Gujarat, Best Endometriosis treatment in Gujarat, Hysterectomy Doctors/Surgery at EVAEva Women's Hospital in Ahmedabad is committed to provide quality treatment by best Gynaecologist in Gujarat. Get Hysterectomy Surgery in Ahmedabad by Doctors at Eva Hospital. We offer best endometriosis treatment in Gujarat.
Mobile version
https://www.evawomenshospital.com/Women's Hospital Ahmedabad, Best Gynaecologist in Gujarat, Best Endometriosis treatment in Gujarat, Hysterectomy Doctors/Surgery at EVAEva Women's Hospital in Ahmedabad is committed to provide quality treatment by best Gynaecologist in Gujarat. Get Hysterectomy Surgery in Ahmedabad by Doctors at Eva Hospital. We offer best endometriosis treatment in Gujarat.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
51hospital44surgery30laparoscopic25dipak24staff
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
hospital
surgery
laparoscopic
dipak
staff
Keywords Cloud Test
accreditationahmedabadbestbringcamecancercancerscarecleanconditionconferencescontactcystsdeepakdipakdischargeddoctordoctorsendometriosisendoscopiceveningexcellentexperiencefacilitiesfamilyfeelfoodfoundergavegoodgreatgujaratgynecologicgynecologisthappyhavehospitalhysterectomieshysterectomyincludingkindlaparoscopiclaparoscopylaproscopiclatestlifelikelimbachiyalivemakemediamedicalnewsnursesoncologyoperatedoperationoperativeovarianovarypainpatelpatientpatientsperformedperiodspostpostedproblemqualityreallyrecoveryroomservicessisterskillsstaffsuccessfulsupportsurgeonsurgeriessurgerysurgicalteamtechnologythankthankstimetotaltrainingtreatmenttubaluterusvariousvisionwifewomenwomensworkworld
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Exceptional Medical Support By Eva Women's Hospital In Ahmedabad
H2 tags
Laparoscopic Surgery
Total Laproscopic Hysterectomy
Endometriosis Treatment
Gynaecological Treatment
Oncology Treatment
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
https://www.evawomenshospital.com/robots.txt
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
https://www.evawomenshospital.com/sitemap.xml
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="UTF-8"
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 80
Failed: 4
Warnings: 3
Passed: 16
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 16.21 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,578 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 60.9 Kb to 16.21 Kb (73% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.71 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
67.1 %
713.10 Kb
javascript
14.5 %
154.04 Kb
other
7.1 %
75.82 Kb
css
6.3 %
67.33 Kb
font
2.9 %
30.99 Kb
html
2.0 %
21.64 Kb
TOTAL
100%
1.04 Mb
Requests by content type
Content type
Percent
Requests
image
60.7 %
34
javascript
16.1 %
9
css
14.3 %
8
html
3.6 %
2
other
3.6 %
2
font
1.8 %
1
TOTAL
100%
56
Content size by domain
Domain
Percent
Size
evawomenshospital.com
79.8 %
848.71 Kb
cdnjs.cloudflare.com
7.7 %
81.96 Kb
googletagmanager.com
4.1 %
43.90 Kb
stackpath.bootstrapcdn.com
3.4 %
36.54 Kb
fonts.gstatic.com
2.9 %
30.99 Kb
google-analytics.com
1.9 %
19.93 Kb
fonts.googleapis.com
0.1 %
903 B
TOTAL
100%
1.04 Mb
Requests by domain
Domain
Percent
Requests
evawomenshospital.com
83.9 %
47
stackpath.bootstrapcdn.com
3.6 %
2
cdnjs.cloudflare.com
3.6 %
2
google-analytics.com
3.6 %
2
fonts.googleapis.com
1.8 %
1
googletagmanager.com
1.8 %
1
fonts.gstatic.com
1.8 %
1
TOTAL
100%
56
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
https://evawomenshospital.com/https://www.evawomenshospital.com/
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.58 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.58 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text:  
Html: <li style="background-image: url("images/slider/img1.jpg"); w..." alt="slider 1" id="slide_17_0">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.043. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0426

0.1

0.25

DOM element which contributes the most to CLS score:
Text:          
Html: <div class="caroufredsel_wrapper caroufredsel_wrapper_slider" style="display: block; text-align: start; float: none; to...">
Score: 0.0424
Server and security
Score: 86
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.evawomenshospital.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
evawomenshospital.com
Subject Alternative Names (SANs)
evawomenshospital.com, www.evawomenshospital.com
Not valid before
Tue, January 24o 2023, 12:00:00 am (z)
Not valid after
Wed, January 24o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 2 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 56
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage is using the noindex meta tag! This means that it will be read but not indexed by search engines.
See results list
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.evawomenshospital.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.evawomenshospital.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 redirect=_spf.mailhostbox.com
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2024 • All rights reserved