seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://elekheat.com/what-is-a-tubular-heater
Your general SEO Checkup Score
Archived
97/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 97 out of 100, which is higher than the average score of 75. Our analysis has identified 12 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
12 Failed
7 Warnings
53 Passed
Issues to fix
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 67
Failed: 4
Warnings: 3
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: What is a tubular heater - Trusted heating element
Length: 50 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 312 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Tubular Heaters: A Guide to Industrial & Finned Heaters | Elekheat Elekheat Request a Quote What is a Tubular Heater? A Complete Guide In the world of industrial and commercial heating, few components are as versatile and reliable as the electric tubular heater. These robust industrial heating elements are the…
Length: 312 characters
Google Search Results Preview Test
Desktop version
https://elekheat.com/what-is-a-tubular-heater/What is a tubular heater - Trusted heating elementTubular Heaters: A Guide to Industrial & Finned Heaters | Elekheat Elekheat Request a Quote What is a Tubular Heater? A Complete Guide In the world of industrial and commercial heating, few components are as versatile and reliable as the electric tubular heater. These robust industrial heating elements are the…
Mobile version
https://elekheat.com/what-is-a-tubular-heater/What is a tubular heater - Trusted heating elementTubular Heaters: A Guide to Industrial & Finned Heaters | Elekheat Elekheat Request a Quote What is a Tubular Heater? A Complete Guide In the world of industrial and commercial heating, few components are as versatile and reliable as the electric tubular heater. These robust industrial heating elements are the…
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:updated_time
2025-07-21T16:53:03+08:00
og:url
https://elekheat.com/what-is-a-tubular-heater/
og:site_name
Trusted heating element
og:locale
en_US
og:type
article
og:title
What is a tubular heater - Trusted heating element
og:description
Tubular Heaters: A Guide to Industrial & Finned Heaters | Elekheat Elekheat Request a Quote What is a Tubular Heater? A Complete Guide In the world of industrial and commercial heating, few components are as versatile and reliable as the electric tubular heater. These robust industrial heating elements are the…
og:image
https://elekheat.com/wp-content/uploads/2025/07/Straight-Formed-Heaters.webp
og:image:secure_url
https://elekheat.com/wp-content/uploads/2025/07/Straight-Formed-Heaters.webp
og:image:width
600
og:image:height
400
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
43heater42tubular38heaters35heating31heat
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
heater
tubular
heaters
heating
heat
Keywords Cloud Test
applicationapplicationsareabarecirculationcoilcomponentsconstructioncontactconvectioncorrosioncorrosivecriticalcustomdeliverdensitydesigndesigneddirectdurableefficiencyefficientelectricelectricalelekheatelementelementsenergyengineeringensureensuresenvironmentsequipmentexplosionfinnedfinsflangegaseshazardousheatheatedheaterheatersheatinghighimmersionincoloyindustrialinstallationlikeliquidliquidslongmaintenancemanufacturingmaterialmaterialsmenumetalmountingoptionsovensperformancephysicalprecisepreventproductproofproperprovideprovidingqualityradiantrangereliablerequiredrequiresresistancerightrobustsafetyscrewservicesheathsimplesizingsolutionsstainlesssteelstepsurfacetemperaturetemperaturestotaltransfertubularusedwattwattagewide
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
What is a Tubular Heater? A Complete Guide
H2 tags
Anatomy of a Tubular Heater
How Tubular Heaters Work
Types of Tubular Heating Elements
Top 5 Industrial Applications
How to Size and Install a Tubular Heater
Visualizing Heat Transfer
Technical Specifications & Materials
Advantages of Tubular Heaters
Custom Tubular Heaters from Elekheat
Quality, Safety, and Hazardous Area Compliance
Maintenance Tips & Troubleshooting
Frequently Asked Questions
Your Partner in Precision Heating
Latest Posts
What is a tubular heater
What are Cartridge Heaters
Successful Delivery of Explosion-Proof Flange Heaters to Iraq for Oil Heating Applications
Explore
Newsletter
Contact
Get In Touch Now!
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 77
Failed: 3
Warnings: 4
Passed: 13
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 900 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 502.91 Kb to 77.24 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.68 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
html
92.1 %
96.30 Kb
css
7.8 %
8.18 Kb
other
0.1 %
100 B
javascript
0.0 %
0 B
image
0.0 %
0 B
font
0.0 %
0 B
TOTAL
100%
104.58 Kb
Requests by content type
Content type
Percent
Requests
other
75.0 %
6
html
12.5 %
1
css
12.5 %
1
javascript
0.0 %
0
image
0.0 %
0
font
0.0 %
0
TOTAL
100%
8
Content size by domain
Domain
Percent
Size
elekheat.com
100.0 %
104.58 Kb
TOTAL
100%
104.58 Kb
Requests by domain
Domain
Percent
Requests
elekheat.com
100.0 %
8
TOTAL
100%
8
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using image resources!
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • This webpage is not using JavaScript resources from the same domain.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.336 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.336 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.292 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.292 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.89 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.89 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: In the world of industrial and commercial heating, few components are as versati...
Html: <p class="text-lg text-gray-600 mb-6">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.1828. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1828

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Elekheat Request a Quote What is a Tubular Heater? A Complete Guide In the worl...
Html: <div class="elementor-element elementor-element-204729b3 e-fle..." data-id="204729b3" data-element_type="container">
Score: 0.1828
Server and security
Score: 82
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "elekheat.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
elekheat.com
Subject Alternative Names (SANs)
elekheat.com, www.elekheat.com
Not valid before
Sat, June 7o 2025, 6:59:32 am (z)
Not valid after
Fri, September 5o 2025, 6:59:31 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 96
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://elekheat.com/what-is-a-tubular-heater/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://elekheat.com/what-is-a-tubular-heater/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.mail.hostinger.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved