seo site checkup logo
PricingFree ToolsArticles
Report generated 5 days ago
https://drunkenelephantmara.com/blog/experience-the-wild-in-comfort-safari-tent-accommodations
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
3 Warnings
56 Passed
Issues to fix
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 87
Failed: 3
Warnings: 0
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Experience the Wild in Comfort: Safari Tent Escapes
Length: 51 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Discover the magic of safari tent accommodations with Drunken Elephant Mara. Immerse yourself in nature with luxury comforts and unforgettable wildlife encounters.
Length: 163 characters
Google Search Results Preview Test
Desktop version
https://drunkenelephantmara.com/blog/experience-the-wild-in-comfort-safari-tent-accommodations/Experience the Wild in Comfort: Safari Tent EscapesDiscover the magic of safari tent accommodations with Drunken Elephant Mara. Immerse yourself in nature with luxury comforts and unforgettable wildlife encounters.
Mobile version
https://drunkenelephantmara.com/blog/experience-the-wild-in-comfort-safari-tent-accommodations/Experience the Wild in Comfort: Safari Tent EscapesDiscover the magic of safari tent accommodations with Drunken Elephant Mara. Immerse yourself in nature with luxury comforts and unforgettable wildlife encounters.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
article
og:title
Experience the Wild in Comfort: Safari Tent Escapes
og:description
Discover the magic of safari tent accommodations with Drunken Elephant Mara. Immerse yourself in nature with luxury comforts and unforgettable wildlife encounters.
og:url
https://drunkenelephantmara.com/blog/experience-the-wild-in-comfort-safari-tent-accommodations/
og:site_name
Masai Mara Safari Blog | Drunken Elephant Mara
og:image
https://drunkenelephantmara.com/blog/wp-content/uploads/2024/04/IMG_4793-scaled.jpg
og:image:width
2560
og:image:height
1920
og:image:type
image/jpeg
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
safari
tent
accommodations
experience
mara
Keywords Cloud Test
accommodationaccommodationsadventureafricanallowingallureamenitiesamidstaprilasleepaugustballoonbeautyblendbreathtakingcallscampcharmchoicecomfortcommunitycontactcosydecemberdistantdrivesdrunkenelephantenjoyingexperienceexperiencesexplorefacilitiesfallingfaqsfebruaryfillingflyingfriendlygallerygamegetawayhomehoneymoonhorseidealimagineimmerseimmersiveitinerariesjanuaryjulyjunejustlandscapesleaveslodgingluxuriesluxuriousluxurymaasaimaramarchmemoriesmenunaturalnaturenightsnovemberoctoberofferperfectpracticesproviderequestretreatridingrusticrustlesafarisavannaseekingseptemberservicesoftsoundsstayingsustainabilitytenttentedtentstodaytravellersunforgettableuniquevillagewalkswildwildernesswildlife
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Experience the Wild in Comfort: Safari Tent Accommodations
H2 tags
Recent Posts
Archives
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 64
Failed: 6
Warnings: 2
Passed: 15
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 9.49 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 43.36 Kb to 9.49 Kb (78% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 5.58 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
74.5 %
1.97 Mb
javascript
17.1 %
463.64 Kb
font
4.2 %
113.78 Kb
css
3.8 %
102.94 Kb
html
0.4 %
9.70 Kb
other
0.0 %
421 B
TOTAL
100%
2.65 Mb
Requests by content type
Content type
Percent
Requests
image
41.2 %
14
css
26.5 %
9
javascript
20.6 %
7
font
5.9 %
2
html
2.9 %
1
other
2.9 %
1
TOTAL
100%
34
Content size by domain
Domain
Percent
Size
drunkenelephantmara.com
84.3 %
2.23 Mb
googletagmanager.com
13.4 %
363.55 Kb
fonts.gstatic.com
1.4 %
38.01 Kb
google-analytics.com
0.8 %
21.51 Kb
fonts.googleapis.com
0.1 %
2.89 Kb
TOTAL
100%
2.65 Mb
Requests by domain
Domain
Percent
Requests
drunkenelephantmara.com
76.5 %
26
googletagmanager.com
8.8 %
3
google-analytics.com
5.9 %
2
fonts.googleapis.com
5.9 %
2
fonts.gstatic.com
2.9 %
1
TOTAL
100%
34
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.308 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.308 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.254 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.254 s

1.8 s

3 s

Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0012. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0012

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0011
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 9
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "drunkenelephantmara.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
drunkenelephantmara.com
Subject Alternative Names (SANs)
drunkenelephantmara.com, www.drunkenelephantmara.com
Not valid before
Tue, October 8o 2024, 12:00:00 am (z)
Not valid after
Wed, October 8o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=10886400;
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
<link href="https://drunkenelephantmara.com/blog/experience-the-wild-in-comfort-safari-tent-accommodations/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +mx +a +ip4:66.29.146.6 +include:spf.web-hosting.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved