seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://dlifeinteriors.com/pune
Your general SEO Checkup Score
Archived
84/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 84 out of 100, which is higher than the average score of 75. Our analysis has identified 6 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
8 Warnings
54 Passed
Issues to fix
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 83
Failed: 1
Warnings: 3
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Interior Designers in Pune | DLIFE Interiors
Length: 44 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 139 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Interior designers in Pune for home interior design. Transform your space with top-rated experts known for creative and functional designs.
Length: 139 characters
Google Search Results Preview Test
Desktop version
https://dlifeinteriors.com/pune/Interior Designers in Pune | DLIFE InteriorsInterior designers in Pune for home interior design. Transform your space with top-rated experts known for creative and functional designs.
Mobile version
https://dlifeinteriors.com/pune/Interior Designers in Pune | DLIFE InteriorsInterior designers in Pune for home interior design. Transform your space with top-rated experts known for creative and functional designs.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
article
og:title
Interior Designers in Pune | DLIFE Interiors
og:description
Interior designers in Pune for home interior design. Transform your space with top-rated experts known for creative and functional designs.
og:url
https://dlifeinteriors.com/pune/
og:site_name
D'LIFE
og:image
https://dlifeinteriors.com/wp-content/uploads/2024/12/Banner-desktop-_Pune.jpg
og:image:width
1920
og:image:height
670
og:image:type
image/jpeg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
65interior37design32pune30designers21life
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
interior
design
pune
designers
life
Keywords Cloud Test
addressannualbengalurubestbudgetcalicutcareerschennaiclientclientscoimbatorecompanycompleteconsultationcontemporarycreatecustomiseddedicateddesigndesignerdesignersdevelopmentdirectdiscountdlifeenquiryensureestimateexceptionalexecutionexperienceexperiencedfamilyfreefriendgalleryhavehelphinjawadihiringhomehomeshyderabadindiainstallationinteriorinteriorskannurkeralakharadikollamkottayamlifelifestylelinksmaduraimaharashtramangalurumodernmumbaimysorenagarnagercoilnaviofferofferspossiblepreferencesprocessproductionproductsprofessionalprojectprojectsprovidepunequalityquickreferrequirementsresidentialroomsaleserviceservicesshowroomsiteskilledsolutionssoonstartstatestyleteamthrissurtimetrivandrumunderstanduniquewoodwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Interior Designers in Pune - D'LIFE Interiors
H2 tags
Buy Direct - 30% Discount
100% Customised Contemporary Home Interiors
India’s Best After-sale Service for Home Interiors
Why Hire the Best Interior Design Company in Pune?
Design, Production & Installation by Just One Company
FAQ
1. How much do interior designers in Pune charge?
2. How do I know my interior design style?
3. What is contemporary interior design?
4. What makes D’LIFE the most popular interior decorator in Pune?
5. What is the cost of hiring an interior designer in Pune?
6. What are the most preferred interior design styles in Pune?
7. Can I consult your interior designer in the experience centre?
8. How long does it take to complete a home interior project?
9. Do you have a discount for interior design packages?
10. What is the process of hiring interior designers at D’LIFE Pune?
11. What are the different ranges of Interior design services offered by D’LIFE?
Start Planning Your Home Interiors Now
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Pinterest 
Speed optimizations
Score: 77
Failed: 3
Warnings: 4
Passed: 14
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 362.57 Kb to 68.46 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.21 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
64.6 %
1.06 Mb
javascript
25.0 %
419.55 Kb
font
4.9 %
82.76 Kb
html
4.3 %
73.02 Kb
other
1.0 %
16.18 Kb
css
0.2 %
3.86 Kb
TOTAL
100%
1.64 Mb
Requests by content type
Content type
Percent
Requests
javascript
32.7 %
18
image
32.7 %
18
other
20.0 %
11
html
5.5 %
3
font
5.5 %
3
css
3.6 %
2
TOTAL
100%
55
Content size by domain
Domain
Percent
Size
cdn-dliin.nitrocdn.com
45.0 %
756.45 Kb
maps.googleapis.com
22.0 %
369.05 Kb
google.com
14.4 %
242.01 Kb
fonts.gstatic.com
4.9 %
82.76 Kb
connect.facebook.net
4.7 %
78.34 Kb
dlifeinteriors.com
4.3 %
72.74 Kb
maps.gstatic.com
4.0 %
67.73 Kb
static.cloudflareinsights.com
0.4 %
6.94 Kb
fonts.googleapis.com
0.2 %
3.86 Kb
nitroscripts.com
0.0 %
761 B
Other
0.0 %
392 B
TOTAL
100%
1.64 Mb
Requests by domain
Domain
Percent
Requests
maps.googleapis.com
36.4 %
20
google.com
32.7 %
18
dlifeinteriors.com
5.5 %
3
fonts.gstatic.com
5.5 %
3
maps.gstatic.com
3.6 %
2
connect.facebook.net
3.6 %
2
fonts.googleapis.com
3.6 %
2
static.cloudflareinsights.com
1.8 %
1
nitroscripts.com
1.8 %
1
cdn-dliin.nitrocdn.com
1.8 %
1
Other
3.6 %
2
TOTAL
100%
55
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.451 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.451 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.448 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.448 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.18 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.18 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img alt="Interior designers in Pune" nitro-lazy-src="https://dlifeinteriors.com/wp-content/uploads/2024..." class="lazyloaded" decoding="async" nitro-lazy-empty="" id="MTEyOToyMzE=-1" src="https://dlifeinteriors.com/wp-content/uploads/2024...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.2362. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.2362

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.2362
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "dlifeinteriors.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
dlifeinteriors.com
Subject Alternative Names (SANs)
dlifeinteriors.com, *.dlifeinteriors.com
Not valid before
Tue, January 28o 2025, 3:16:52 am (z)
Not valid after
Mon, April 28o 2025, 4:16:44 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://dlifeinteriors.com/pune/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://dlifeinteriors.com/pune/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx ip4:208.100.49.128/28 ip4:103.60.218.0/24 ip4:103.77.114.0/24 ip4:103.81.181.0/24 ip4:103.116.158.0/24 ip4:103.81.137.0/24 include:mlrcloud.com include:_spf.google.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved