seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://digitalnexio.com
Your general SEO Checkup Score
Archived
79/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 79 out of 100, which is higher than the average score of 74. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
5 Warnings
56 Passed
Issues to fix
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
Replace deprecated HTML tags with their modern equivalents or appropriate CSS rules.
Common SEO issues
Score: 64
Failed: 6
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 66 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Discover Insightful Content on Marketing, Business, and Technology
Length: 66 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Explore our expert-curated blogging insights! Discover comprehensive guides, latest trends, and actionable tips to elevate your blogging skills and engage your audience effectively.
Length: 181 characters
Google Search Results Preview Test
Desktop version
https://digitalnexio.com/Discover Insightful Content on Marketing, Business, and TechnologyExplore our expert-curated blogging insights! Discover comprehensive guides, latest trends, and actionable tips to elevate your blogging skills and engage your audience effectively.
Mobile version
https://digitalnexio.com/Discover Insightful Content on Marketing, Business, and TechnologyExplore our expert-curated blogging insights! Discover comprehensive guides, latest trends, and actionable tips to elevate your blogging skills and engage your audience effectively.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Discover Insightful Content on Marketing, Business, and Technology
og:description
Explore our expert-curated blogging insights! Discover comprehensive guides, latest trends, and actionable tips to elevate your blogging skills and engage your audience effectively.
og:url
https://digitalnexio.com/
og:site_name
DIGITAL NEXIO
og:updated_time
2024-07-07T17:24:27+01:00
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
28june23digitalnexio19july19january12lifestyle
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
june
digitalnexio
july
january
lifestyle
Keywords Cloud Test
agreeagreementaheadandroidanimationautomobilesbestblockerblogbreakthroughbusinesscameracertifiedchanelcheckchoosecompletecomprehensivecreativedancedesigndigitalnexiodoesdreamdronedualeastereconomyfacebookfashionfinancefintechzoomfoobarfriendsgalaxyguidehealthhelphologramhomeimagesindiainstagramintroductionjanuaryjapanjulyjunekrogerlatestlifestylelongmarketmusicneednewsnvidiaonlineordinaryphonepinterestplaypolicypredictionspriceprivacyrealredmireviewrightsamsungseasonsectorsecuresigningskinsmallsmilingspecialstepstocksubscribetattoostechnologytermstimetipstodaytransformstrendingtwitterupdatesupgradesvaluewatchwifiwomenworldxiaomiyoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H2 tags
Samsung Galaxy S23 Review: the Android Phone for Everyone
Review: Xiaomi Redmi 13C: Small Upgrades, Big Value
Get this 4K HD Dual-Camera Drone with WiFi for $75
Tips To Get The Most Out Of Your New Nvidia RTX 2060
Hologram Breakthrough – New Technology Transforms Ordinary 2D Images
How to Set Up Kroger VPN: A Step-by-Step Guide (2024)
Special Offers on Manavis Skin Care Products
DIY Dance Clip Art: Crafting Your Own Dance Concept (2024)
Trending Leg Tattoos for Women in 2024
How to Choose the Right Easter Wreaths for Your Home (2024)
Wire Club vs Yesichat: Which One Should You Choose in June 2024?
Buy or Sell: Fintechzoom SQ Stock Price Predictions 2024
How to Secure the Best Deals on Badlands Ranch Dog Food Online
Top 10 Japan Travel Packages for First-Time Visitors in 2024
10 Affordable Y3K Fashion Trends You Need to Know About
Rate Your Music: Essential Tips for Better Reviews
Top 10 Ways Cepanoa Health Improves Your Mental Health
var cid = "6880918057"; var pid = "ca-pub-5941651432041795"; var slotId = "div-gpt-ad-Content_4/88cfc6d6ec6703cde9a3476c59bd72ab-0"; var ffid = 1; var alS = 1037 % 1000; if(typeof ez_ad_units == "undefined"){ez_ad_units=[];}ez_ad_units.push([[300,250],"Content_4/88cfc6d6ec6703cde9a3476c59bd72ab","ezslot_5",109,"0","0", "Content_4/88cfc6d6ec6703cde9a3476c59bd72ab-0"]); var container = document.getElementById(slotId); if (container) { var ins = document.createElement("ins"); ins.id = slotId + "-asloaded"; ins.className = "adsbygoogle ezasloaded"; ins.dataset.adClient = pid; ins.dataset.adChannel = cid; ins.style.display = "block"; ins.style.minWidth = container.attributes.ezaw.value + "px"; ins.style.width = "100%"; ins.style.height = container.attributes.ezah.value + "px"; ins.style.margin = "0px auto"; container.style.maxHeight = container.style.minHeight + "px"; container.style.maxWidth = container.style.minWidth + "px"; var script = document.createElement("script"); script.innerText = "(adsbygoogle = window.adsbygoogle || []).push({});"; ins.appendChild(script); container.appendChild(ins); window.ezoSTPixels = window.ezoSTPixels || []; if (typeof ezoSTPixelAdd === "function") { window.ezoSTPixelAdd(slotId, "stat_source_id", 44); window.ezoSTPixelAdd(slotId, "adsensetype", 1); } else { window.ezoSTPixels.push({id: slotId, name: "stat_source_id", value: 44}); window.ezoSTPixels.push({id: slotId, name: "adsensetype", value: 1}); } window.ezaslWatch = window.ezaslWatch || []; window.ezaslWatch.push(slotId); }(adsbygoogle = window.adsbygoogle || []).push({});How to Set Up Kroger VPN: A Step-by-Step Guide (2024)
Best Chanel Perfume of 2024 – Top Chanel Fragrance Worth Buying
How to Watch Smiling Friends Season 2 Online: A Complete Guide
Anime Update: Latest News and Releases in the World of Anime
GTA 6 System Requirements: Is Your Rig Powerful Enough?
Fortnite Refer a Friend 3.0: Play Together & Earn Rewards!
How Long Does It Take to Get 8a Certified? A Comprehensive Guide
Exploring the 7 Benefits of Sabine State Bank’s Mortgage Options
Why FSI Blog Net is a Must-Have for Modern Businesses (2024)
Stock Market Holidays 2024 India: All You Need
The Real Sector in the Economy: A Comprehensive Analysis
Tesla FSD Free Trial: User Experiences and Reviews
Top 10 Lifestyle Automobiles for 2024 | Innovative Designs
Upcoming Taycan Becomes Fastest Porsche EV at Nürburgring
How to Profit from Gujarat Market Satta King Chart 2024
Where to Buy Oaksmith Gold: Best Prices and Stores (2024)
Watch the Fastest Sky Train in Japan Zoom Through the Air
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
2center
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 80
Failed: 5
Warnings: 1
Passed: 19
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,563 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 611.78 Kb to 129.67 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.3 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
42.0 %
1005.56 Kb
css
21.1 %
506.60 Kb
font
14.3 %
343.40 Kb
image
12.6 %
302.33 Kb
html
5.1 %
123.17 Kb
other
4.8 %
115.20 Kb
TOTAL
100%
2.34 Mb
Requests by content type
Content type
Percent
Requests
javascript
31.1 %
47
other
29.1 %
44
css
17.2 %
26
image
16.6 %
25
font
5.3 %
8
html
0.7 %
1
TOTAL
100%
151
Content size by domain
Domain
Percent
Size
digitalnexio.com
49.2 %
1.15 Mb
go.ezodn.com
16.0 %
384.21 Kb
securepubads.g.doubleclick.net
10.5 %
250.98 Kb
pagead2.googlesyndication.com
8.7 %
207.89 Kb
googletagmanager.com
7.6 %
182.98 Kb
fonts.gstatic.com
2.8 %
67.78 Kb
eba3etko4ik.exactdn.com
0.8 %
19.75 Kb
fonts.googleapis.com
0.8 %
18.07 Kb
the.gatekeeperconsent.com
0.7 %
15.67 Kb
static.criteo.net
0.6 %
13.30 Kb
Other
2.3 %
56.16 Kb
TOTAL
100%
2.34 Mb
Requests by domain
Domain
Percent
Requests
digitalnexio.com
33.1 %
50
go.ezodn.com
21.2 %
32
g.ezoic.net
11.9 %
18
securepubads.g.doubleclick.net
4.6 %
7
fonts.gstatic.com
2.0 %
3
pagead2.googlesyndication.com
2.0 %
3
the.gatekeeperconsent.com
1.3 %
2
fonts.googleapis.com
1.3 %
2
googletagmanager.com
1.3 %
2
googleads.g.doubleclick.net
1.3 %
2
Other
19.9 %
30
TOTAL
100%
151
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.645 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.645 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.477 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.477 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.48 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.48 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img loading="lazy" decoding="async" width="630" height="630" src="https://digitalnexio.com/wp-content/uploads/2024/0..." class="attachment-bunyad-feat-grid-lg-vw size-bunyad-feat..." alt="Clip art of people dancing in various styles, incl..." sizes="(max-width: 936px) 100vw, 936px" title="DIY Dance Clip Art: Crafting Your Own Dance Concep...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0003. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0003

0.1

0.25

DOM element which contributes the most to CLS score:
Text: ×
Html: <span id="div-gpt-ad-Adhesion/88cfc6d6ec6703cde9a3476c59bd72..." ezaw="728" ezah="90" style="position:relative;z-index:0;display:inline-block;p..." class="ezoic-ad" data-google-query-id="CN3lkYyjqYcDFeKGywEdef8Gxg">
Score: 0.0003
Server and security
Score: 97
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "digitalnexio.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
digitalnexio.com
Subject Alternative Names (SANs)
digitalnexio.com, www.digitalnexio.com
Not valid before
Fri, June 28o 2024, 5:17:45 am (z)
Not valid after
Thu, September 26o 2024, 5:17:44 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
WR1
Intermediate certificate
Common name
WR1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Root certificate
Common name
GTS Root R1
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://digitalnexio.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://digitalnexio.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf.mail.hostinger.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but it contains duplicated or invalid records! These warnings highlight points of concern which should not affect the processing of the authorized sellers list, but which should be resolved as soon as possible.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved