seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://dev.to/taryn_j_white
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 87 out of 100, which is higher than the average score of 74. Our analysis has identified 6 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
2 Warnings
59 Passed
Common SEO issues
Score: 76
Failed: 4
Warnings: 0
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Taryn J. White - DEV Community 👩‍💻👨‍💻
Length: 37 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Tech data legal analyst and First DUI Lawyer at FindLaw FightDUICharges Nolo Justia attorney offices for DUI defense, suspended license hearings. Contact Info: FightDUICharges Law, Phone: 866-256-0566
Length: 200 characters
Google Search Results Preview Test
Desktop version
https://dev.to/taryn_j_whiteTaryn J. White - DEV Community 👩‍💻👨‍💻Tech data legal analyst and First DUI Lawyer at FindLaw FightDUICharges Nolo Justia attorney offices for DUI defense, suspended license hearings. Contact Info: FightDUICharges Law, Phone: 866-256-0566
Mobile version
https://dev.to/taryn_j_whiteTaryn J. White - DEV Community 👩‍💻👨‍💻Tech data legal analyst and First DUI Lawyer at FindLaw FightDUICharges Nolo Justia attorney offices for DUI defense, suspended license hearings. Contact Info: FightDUICharges Law, Phone: 866-256-0566
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
7fightduicharges6account6legal5taryn5attorney
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
fightduicharges
account
legal
taryn
attorney
Keywords Cloud Test
abuseaccidentaccountanalysisanalystanalyzingapplyingassessmentattorneyauthoravailablebadgebadgesbasedcasecelebratesclientclientscloudclubcodingcommunityconnectcontactcontentcourtcreatecreatingcriticalcurrentlydefensedepauldesigndeveloperseducationenglishfeaturesfightduichargesfindlawfirmfollowforemfrenchhackinghavehearingshttpsincludesinclusiveinfoinnovativejavascriptjoinedjurisdictionjustialanguageslawyerlearninglegallicenselitigationlocallongevitymembernolooffenseofficeofficesorganizationsphoneplatformpolishpracticeprovidepythonregisteredreportresearchreviewsservicesheetssignskillsskipsoftwarespanishspeakingstrategiessupportsuspendedtagstarynteamtechtechnologytoolstrustedwhiteworkyear
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Taryn J. White
H2 tags
DEV Community 👩‍💻👨‍💻
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Twitter 
Speed optimizations
Score: 88
Failed: 2
Warnings: 1
Passed: 17
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 10.79 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 40.49 Kb to 10.79 Kb (73% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.05 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
80.1 %
458.35 Kb
css
14.1 %
80.73 Kb
image
3.4 %
19.57 Kb
html
2.0 %
11.35 Kb
other
0.4 %
2.33 Kb
font
0.0 %
0 B
TOTAL
100%
572.33 Kb
Requests by content type
Content type
Percent
Requests
javascript
63.4 %
26
other
14.6 %
6
css
9.8 %
4
image
9.8 %
4
html
2.4 %
1
font
0.0 %
0
TOTAL
100%
41
Content size by domain
Domain
Percent
Size
dev.to
79.7 %
456.03 Kb
googletagmanager.com
13.3 %
76.35 Kb
google-analytics.com
3.5 %
20.09 Kb
res.cloudinary.com
3.0 %
17.41 Kb
dev-to-uploads.s3.amazonaws.com
0.4 %
2.16 Kb
stats.g.doubleclick.net
0.1 %
302 B
TOTAL
100%
572.33 Kb
Requests by domain
Domain
Percent
Requests
dev.to
78.0 %
32
res.cloudinary.com
7.3 %
3
google-analytics.com
7.3 %
3
dev-to-uploads.s3.amazonaws.com
2.4 %
1
googletagmanager.com
2.4 %
1
stats.g.doubleclick.net
2.4 %
1
TOTAL
100%
41
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test
  • This webpage is not using images with large metadata.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.0. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0001

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Follow
Html: <button id="user-follow-butt" class="crayons-btn whitespace-nowrap follow-action-button..." data-info="{"id":802119,"className":"User","name":"Taryn J. W..." data-fetched="fetched" aria-label="Follow user: Taryn J. White" aria-pressed="false">
Score: 0.0001
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "dev.to" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
dev.to
Subject Alternative Names (SANs)
dev.to
Not valid before
Tue, August 30o 2022, 9:45:08 pm (z)
Not valid after
Sun, October 1o 2023, 9:45:07 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign Atlas R3 DV TLS CA 2022 Q3
Intermediate certificate
Common name
GlobalSign Atlas R3 DV TLS CA 2022 Q3
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, April 20o 2022, 12:00:00 pm (z)
Not valid after
Sun, April 20o 2025, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Root certificate
Common name
GlobalSign
Organization
GlobalSign
Not valid before
Wed, March 18o 2009, 10:00:00 am (z)
Not valid after
Sun, March 18o 2029, 10:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31557600
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, viewport-fit=cover" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://dev.to/taryn_j_white is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://dev.to/taryn_j_white" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 a mx include:_spf.google.com include:sendgrid.net include:servers.mcsv.net include:shops.shopify.com ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved