seo site checkup logo
PricingFree ToolsArticles
Report generated 9 years ago
http://dev.netdania.com/quotes/forex-majors
Your general SEO Checkup Score
Archived
62/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 62 out of 100, which is below the average score of 75. However, there are 13 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
13 Failed
1 Warnings
26 Passed
Common SEO issues
Score: 67
Failed: 3
Warnings: 1
Passed: 11
Google Search Results Preview
Desktop version
http://dev.netdania.com/quotes/forex-majors Forex Majors | Quote List, currency exchange rates - NetDania Real-time NetDania QuoteList of financial forex exchange rates of Forex Majors including Bid, Ask, Change, High and Low and currency convertor
Mobile version
http://dev.netdania.com/quotes/forex-majors Forex Majors | Quote List, currency exchange rates - NetDania Real-time NetDania QuoteList of financial forex exchange rates of Forex Majors including Bid, Ask, Change, High and Low and currency convertor
Keywords Cloud
[readadviceappetiteappletapplicationapplicationsassociatedaud/usdawarebrentcarefullycashchangeclickcommentsconditionsconsidercontactcookiescopenhagencvrnrdatadenmarkdoesdownloadseur/chfeur/gbpeur/jpyeur/usdexchangeexperiencefeaturesfeatures]financialfloorforeignforexftsegbp/jpygbp/usdglobalgoldguaranteehavinghighhongindependentindexinstrumentinvestinvestmentjavajones(cfdkong(cfdkronprinsessegadelevellistlossesmajorsmakingmarketmarketsmobilenasdaqnetdanianewsniftynikkeinzd/usdobjectivespolicypricingprivacyproblemsproductsprovidedquotequotelistratesrealtimereferencesriskrisksseeksendservershanghaisharesignsupporttermstradingtrialtweetusd/cadusd/chfusd/jpyusdollarviewingwebsite
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test
  • This analyzed URL is SEO friendly, but internal links on this page contain some links that are not SEO friendly.
See results list
Image Alt Test
  • Your webpage has 91 'img' tags and 21 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 60 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the correct version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
Speed optimizations
Score: 40
Failed: 6
Warnings: 0
Passed: 4
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 193.00 Kb to 57.84 Kb (70 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 10.284 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 176
  • 18 HTML Pages
  • 19 CSS Files
  • 80 JS Files
  • 54 Images
  • 5 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduce server load.
Flash Test
  • Warning: your website contains flash objects. Flash is an outdated technology that is used to deliver rich multimedia content. Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
See results list
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • It appears that your site contains nested tables. Nested tables can be slow to render in some browsers. Consider using a CSS layout to reduce both HTML size and page loading time.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
Server and security
Score: 66
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved