seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://demohotelimperia.netlify.app
Your general SEO Checkup Score
Archived
95/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 95 out of 100, which is higher than the average score of 75. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
2 Warnings
56 Passed
Issues to fix
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 65
Failed: 6
Warnings: 1
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Hotel Imperia : Home
Length: 20 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 106 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Learn more about Hotel Imperia at Madhurawada, Visakhapatnam, including our history, values, and services.
Length: 106 characters
Google Search Results Preview Test
Desktop version
https://demohotelimperia.netlify.app/Hotel Imperia : HomeLearn more about Hotel Imperia at Madhurawada, Visakhapatnam, including our history, values, and services.
Mobile version
https://demohotelimperia.netlify.app/Hotel Imperia : HomeLearn more about Hotel Imperia at Madhurawada, Visakhapatnam, including our history, values, and services.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
6gallery6hotel6imperia4room4menu
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
gallery
hotel
imperia
room
menu
Keywords Cloud Test
affordableamenitiesbestbookbookingbringbusinesscatercateringcheckcheckoutchefscleancomfortcomfortableconferencesconsistentlycontactconventioncourteousdedicateddeliciousdesigneddestinationdiscoverdishesdivineelegantlyendeavourensuresensuringequippedescapadeetherealeventeventsexceptionalexperienceexpertexploreexquisitefamilyflavorsfoodfunctiongallerygmailgreathallhighlyhomehosthotelimperiajagankommadhikongaraconventionslearnleisurelovemaintainedmemorablemenumodernmoneyneedsnotchofferoffersoptionperfectpremierpreparedrangereadrecommendedrelaxingrestaurantrevolutionaryroomroomsroyaltyseamlesssimplyspaciousstaffstaystorytimetravelerunmatchedvalueviewvikasvisakhapatnamvisitvisitingweddingswelcomewonderful
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
OUR STORY
H2 tags
Experience Unmatched Comfort
Host Memorable Events
For the Love of Delicious Food
We Offer Top Notch
Order Online From Hotel Imperia
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 90
Failed: 2
Warnings: 0
Passed: 18
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 11.08 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 203 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 65.73 Kb to 11.08 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.64 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
image
99.7 %
20.45 Mb
javascript
0.2 %
42.58 Kb
html
0.0 %
10.35 Kb
css
0.0 %
5.09 Kb
font
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
20.51 Mb
Requests by content type
Content type
Percent
Requests
image
81.3 %
13
html
6.3 %
1
css
6.3 %
1
javascript
6.3 %
1
font
0.0 %
0
other
0.0 %
0
TOTAL
100%
16
Content size by domain
Domain
Percent
Size
demohotelimperia.netlify.app
99.8 %
20.46 Mb
unpkg.com
0.2 %
47.67 Kb
TOTAL
100%
20.51 Mb
Requests by domain
Domain
Percent
Requests
demohotelimperia.netlify.app
87.5 %
14
unpkg.com
12.5 %
2
TOTAL
100%
16
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.024 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.024 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 4.241 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

4.241 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.2 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.2 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Experience Unmatched Comfort Spacious and elegantly designed rooms for a relaxi...
Html: <div class="swiper-slide swiper-slide-active" style="background-image: url("images/roomthe.jpg"); width..." role="group" aria-label="1 / 3" data-swiper-slide-index="0">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0001. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0001

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0001
Server and security
Score: 73
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "demohotelimperia.netlify.app" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.netlify.app
Organization
Netlify, Inc
Location
San Francisco, California, US
Subject Alternative Names (SANs)
*.netlify.app, netlify.app
Not valid before
Fri, January 31o 2025, 12:00:00 am (z)
Not valid after
Tue, March 3o 2026, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global G2 TLS RSA SHA256 2020 CA1
Intermediate certificate
Common name
DigiCert Global G2 TLS RSA SHA256 2020 CA1
Organization
DigiCert Inc
Location
US
Not valid before
Tue, March 30o 2021, 12:00:00 am (z)
Not valid after
Sat, March 29o 2031, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Root certificate
Common name
DigiCert Global Root G2
Organization
DigiCert Inc
Location
US
Not valid before
Thu, August 1o 2013, 12:00:00 pm (z)
Not valid after
Fri, January 15o 2038, 12:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 29
Failed: 3
Warnings: 1
Passed: 5
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved