seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
http://deals24hours.pk
Your general SEO Checkup Score
Archived
79/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 79 out of 100, which is higher than the average score of 75. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
1 Warnings
42 Passed
Common SEO issues
Score: 87
Failed: 2
Warnings: 0
Passed: 18
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Online Shopping in Pakistan: Buy Fashion, Electronics, Beauty And Cosmetics , Kitchen And Dining , Mobile Accessories , Tools and Gadgets , Others Deals | deals24hours.pk
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: deals24hours.pk offers Online shopping in Pakistan. Buy Mens / Womens clothing, jewellery, watches, electronics, Beauty And Cosmetics, kitchen and Dining , Mobile Accessories , Tools and Gadgets and more. Pay Cash on Delivery. Free Delivery.
Google Search Results Preview Test
Desktop version
http://deals24hours.pkOnline Shopping in Pakistan: Buy Fashion, Electronics, Beauty And Cosmetics , Kitchen And Dining , Mobile Accessories , Tools and Gadgets , Others Deals | deals24hours.pkdeals24hours.pk offers Online shopping in Pakistan. Buy Mens / Womens clothing, jewellery, watches, electronics, Beauty And Cosmetics, kitchen and Dining , Mobile Accessories , Tools and Gadgets and more. Pay Cash on Delivery. Free Delivery.
Mobile version
http://deals24hours.pkOnline Shopping in Pakistan: Buy Fashion, Electronics, Beauty And Cosmetics , Kitchen And Dining , Mobile Accessories , Tools and Gadgets , Others Deals | deals24hours.pkdeals24hours.pk offers Online shopping in Pakistan. Buy Mens / Womens clothing, jewellery, watches, electronics, Beauty And Cosmetics, kitchen and Dining , Mobile Accessories , Tools and Gadgets and more. Pay Cash on Delivery. Free Delivery.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
13cart5cosmetics4beauty4matte4pack
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accountappliancesbagfeaturesbanglesbeautybestblogblusherbraceletsbrushescartcategoriescheckoutcleanerclearclothingcolorlongcosmeticsdecaydelicadesigneddifferentdiningearingseasyelectronicseyebrowfashiongadgetsglossglossesglossfeaturesglossvolumehairhearthighlighterhighlighterfeatureshomehudainformationitemjewellerykarakemeikitchenlastinglightlipstickliquidlistlocketloginlongloosemakeupmattmattemensmissnakednaturalnecklaceonlinepackpakistanpersonalpowderpowerproductsprofessionalregisterringsrollroseservicessetsshadesshadestheshaversshoppingsilversitemapsmoothstraightenerstrencilzstrencilzfeaturestartetoolstopstrimmertrimmersurbanushasvestwatcheswearwishwomenwomenszipper
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Online Shopping in Pakistan
H2 tags
Deals24hours.pk -- Every Day You Get Our Best Best Products Ushas Eyebrow Kit with Brushes and strencilz Ushas Eyebrow Kit with Brushes and strencilzFeatures :Easy to Wear,Long-lasting,Natural Net Wei.. Rs.900 Add to Cart Huda Beauty 16pcs Matte Lipstick Huda Beauty Liquid Matte Lipstick Set Of 16 Shades Which Is Must Have For Your Personal Makeup Kit I.. Rs.1,600 Add to Cart Pack of 6 Tarte Heart Blusher Highlighter Pack of 6 Tarte Heart Blusher HighlighterFeatures :6 different ShadesThe powder is smooth and delica.. Rs.2,000 Add to Cart naked 4 urban decay pack of 6 matte lip gloss naked 4 urban decay pack of 6 matte lip glossFeatures :6 different colorLong lasting lip glossVolume.. Rs.800 Add to Cart Roll-n-Go Cosmetics Bag Roll-n-Go Cosmetics BagFeatures:4 clear zipper pockets provides organizationFolds up from a snap but.. Rs.700 Add to Cart Miss Rose Matt Lip Glosses Set 12 pcs Miss Rose Matt Lip Glosses Set 12 pcsFeatures :Random Clours Long Lasting Lip Gloss24 Hours Sta.. Rs.1,800 Add to Cart Kemei Professional Trimmer KM-27C Kemei Professional Hair Trimmer for Hair RemovalFeatures:Power Supply : ElectricCharging Time :.. Rs.1,500 Add to Cart Riddex Plus Features :Humanely Repells Rodents, Mouse , Cockroaches , Ants and Spider NON-TOXIC, NO CHEMICA.. Rs.1,000 Add to Cart AIWA 40pc Combination Socket Wrench Set The 40pc multipurpose set includes a wide range of sockets that can be used for cars, bikes and home.. Rs.850 Add to Cart Slim ‘N Lift Slimming Vest for Men His vest-shaped, shirt is designed to give you abdominal support, reduce waist, and reinforce the lo.. Rs.899 Add to Cart Mini Car Vacume Cleaner With Light 12 volts high power vacuum cleaner for your car with work light & ON/OFF switch, with super suct.. Rs.1,200 Add to Cart <!-- $('#carousel0').owlCarousel({ items: 6, autoPlay: 3000, navigation: true, navigationText: ['<i class="fa fa-chevron-left fa-5x"></i>', '<i class="fa fa-chevron-right fa-5x"></i>'], pagination: true }); -->
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • All of your webpage's "img" tags have the required "alt" attribute.
Inline CSS Test
  • Congratulations! Your webpage is not using any inline CSS styles.
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 74
Failed: 3
Warnings: 1
Passed: 12
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 5.49 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 33.14 Kb to 5.49 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 1.38 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 30
  • 1 HTML Pages
  • 6 CSS Files
  • 4 JS Files
  • 19 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 66
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 44
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 ip4:167.88.160.90 ip4:167.88.160.99 ip4:104.223.127.2 +a +mx +ip4:205.185.112.54 +ip4:167.88.160.71 +include:spf.cpanelplatform.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved