seo site checkup logo
PricingFree ToolsArticles
Report generated 3 months ago
https://dealerhinojakarta.co.id
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 85 out of 100, which is higher than the average score of 75. Our analysis has identified 16 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
16 Failed
2 Warnings
54 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Add a meta description tag to provide a brief and informative summary of the page's content for search engines.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a Time To First Byte value of 0.8 seconds or less.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 59
Failed: 6
Warnings: 0
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Dealer Hino Jakarta - Dealer Resmi Hino
Length: 39 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is not using a meta description tag! You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://dealerhinojakarta.co.id/Dealer Hino Jakarta - Dealer Resmi Hino
Mobile version
https://dealerhinojakarta.co.id/Dealer Hino Jakarta - Dealer Resmi Hino
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
id_ID
og:type
website
og:title
Dealer Hino Jakarta
og:description
#Dapatkan Harga dan Penawaran Terbaik Dari Kami * Apakah Anda membutuhkan Harga terbaru Segala Jenis Truck Hino? * Anda bingung memilih kendaraan yang cocok untuk bisnis anda? * Anda ingin mendapatkan pelayanan yang cepat dan profesional ? * Anda ingin mendapatkan penawaran terbaik ? Anda berada di Website yang tepat. kami akan membantu segala kebutuhan Bisnis Anda.Kami Melayani Penjualan di Seluruh Indonesia dengan layanan Profesional dan Terbaik! Informasi Pembelian katagori Produk Pilih Kendaraan Impian Anda! Klik Detail Klik Detail Klik Detail Klik Detail Klik Detail ☆ ☆ ☆ ☆ ☆ Testimoni Pelanggan “Kami telah menggunakan Hino FM 280 JM untuk pengiriman material konstruksi, dan kami sangat puas dengan kinerjanya! Truk ini sangat kuat, efisien, dan memiliki kapasitas yang sangat besar. Tidak hanya itu, pelayanan dari tim Ka Anton juga luar biasa, sangat cepat dan responsif.” – Andi S., Pemilik Perusahaan Konstruksi andi ☆ ☆ ☆ ☆ ☆ Testimoni Pelanggan “Kami telah menggunakan Hino FM 280 JM untuk pengiriman material konstruksi, dan kami sangat puas dengan kinerjanya! Truk ini sangat kuat, efisien, dan memiliki kapasitas yang sangat besar. Tidak hanya itu, pelayanan dari tim Ka Anton juga luar biasa, sangat cepat dan responsif.” – Andi S., Pemilik Perusahaan Konstruksi andi ☆ ☆ ☆ ☆ ☆ Testimoni Pelanggan “Dutro 136 MDL sangat cocok untuk usaha distribusi saya. Dimensinya pas, lincah di jalan sempit, dan hemat bahan bakar. Pengiriman jadi lebih efisien dan tepat waktu. Terima kasih Ka Anton atas bantuannya!” – Budi K., Usaha Distribusi Barang Kelontong BUDI ☆ ☆ ☆ ☆ ☆ Testimoni Pelanggan “Hino FM 280 JD benar-benar terbukti tangguh di lapangan. Kami mengandalkan unit ini untuk operasional berat di proyek tambang dan hasilnya sangat memuaskan. Power kuat, kapasitas besar, dan efisiensi BBM-nya sangat membantu kami menekan biaya operasional. Terima kasih kepada tim Ka Anton yang selalu cepat tanggap dan profesional!” – Safei, Owner PT. Jatra Gading Utama PT.JATRA GADING UTAMA Dapatkan Penawaran Harga Terbaik Hino Trucks – Solusi Terbaik untuk Kesuksesan Bisnis Anda. Hubungi kami sekarang dan temukan Unik Hino dapat memberikan keunggulan kompetitif bagi bisnis Anda! Contact Sales All Content Creation Graphic Design Hino dutro Produk SEO Web Design   Back Speksifikasi Harga hino Produk Hino 500 FM 280 JD | Truk 10 Roda Dump & Tangki Berat Mei 11, 2025Read More Produk Hino 500 FM 280 JW | Truk Heavy Duty 6×4 Karoseri Dump & Bak Mei 11, 2025Read More Produk Hino 500 FL 260 JW | Truk Panjang 10 Roda Karoseri Box & Wingbox Mei 11, 2025Read More Produk Hino 500 FG 260 JS | Truk 6 Roda Fleksibel Karoseri Dump / Bak Mei 11, 2025Read More Prev123Next
og:url
https://dealerhinojakarta.co.id/
og:site_name
Dealer Resmi Hino
og:image
https://dealerhinojakarta.co.id/wp-content/uploads/2025/04/slide-hinoe-ranger2022.jpg
og:image:width
1110
og:image:height
419
og:image:type
image/jpeg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
29hino24sangat20untuk19dutro18kami
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
hino
sangat
untuk
dutro
kami
Keywords Cloud Test
andaandiangkutanantonbahanbakarbarangbenarberatbesarbesibiasabiayabisnisbudicepatcocokdapatkandaridengandistribusidutroefisienefisiensigadinghadirhandalhanyahargahasilnyahinoinginiritjatrajugakamikapasitaskaroserikasihkebutuhankendaraankepadakeunggulankinerjanyaklikkokohkonstruksikuatlapanganlebihlogistikluarmaterialmembantumembutuhkanmemilikimemuaskanmendapatkanmenekanmengandalkanmenggunakanmudahoperasionalownerpelangganpelayananpemilikpenawaranpengirimanperusahaanpowerprodukprofesionalproyekpuasreadresponsifsafeisalessangatsegalaselaluspesifikasitambangtanggaptangguhtelahtepatterbaikterbuktiterimatestimonitidaktrukunituntukusahautamawhatsappyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
katagori Produk
Testimoni Pelanggan
Dapatkan Penawaran Harga Terbaik
Hino Dutro 136 MDL Karoseri Bak | Truk Handal Angkutan Berat
Hino Dutro 136 HDL Karoseri Box Besi | Truk Logistik Kokoh & Elegan
Hino Dutro 115 SDL – Truk Tangguh dan Irit untuk Menunjang Bisnis Anda
Review Hino Dutro 136 HD Spesifikasi Lengkap & Rekomendasi Usaha 2025
INFORMASI SALES
Dealer Hino Terbesar
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 56
Failed: 8
Warnings: 1
Passed: 11
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 714 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 255.32 Kb to 47.06 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 12.65 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
65.4 %
3.29 Mb
javascript
23.1 %
1.16 Mb
font
8.3 %
427.59 Kb
css
1.9 %
96.79 Kb
html
1.2 %
63.67 Kb
other
0.0 %
2.15 Kb
TOTAL
100%
5.03 Mb
Requests by content type
Content type
Percent
Requests
javascript
50.4 %
68
css
20.7 %
28
image
14.8 %
20
font
8.9 %
12
html
3.0 %
4
other
2.2 %
3
TOTAL
100%
135
Content size by domain
Domain
Percent
Size
dealerhinojakarta.co.id
87.9 %
4.42 Mb
karoseri-trb.com
5.6 %
291.13 Kb
googletagmanager.com
5.2 %
266.88 Kb
dealermitsubishi.co.id
1.2 %
59.88 Kb
googleads.g.doubleclick.net
0.0 %
2.55 Kb
googleadservices.com
0.0 %
1.44 Kb
google.com
0.0 %
649 B
td.doubleclick.net
0.0 %
605 B
TOTAL
100%
5.03 Mb
Requests by domain
Domain
Percent
Requests
dealerhinojakarta.co.id
84.4 %
114
karoseri-trb.com
6.7 %
9
googletagmanager.com
2.2 %
3
google.com
2.2 %
3
dealermitsubishi.co.id
1.5 %
2
td.doubleclick.net
1.5 %
2
googleads.g.doubleclick.net
0.7 %
1
googleadservices.com
0.7 %
1
TOTAL
100%
135
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 3.818 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

3.818 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 6.041 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

6.041 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 11.96 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

11.96 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="elementor-background-slideshow__slide__image" style="background-image: url("https://dealerhinojakarta.c...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0

0.1

0.25

DOM element which contributes the most to CLS score:
Html: <div class="ht-ctc ht-ctc-chat ctc-analytics ctc_wp_desktop st..." id="ht-ctc-chat" style="position: fixed; bottom: 15px; left: 15px; cursor:...">
Score: 0.0000
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "dealerhinojakarta.co.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.dealerhinojakarta.co.id
Subject Alternative Names (SANs)
*.dealerhinojakarta.co.id, dealerhinojakarta.co.id, dealerhinojakarta.co.id.hinodutro.com, www.dealerhinojakarta.co.id.hinodutro.com
Not valid before
Wed, May 21o 2025, 9:22:05 pm (z)
Not valid after
Tue, August 19o 2025, 9:22:04 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, viewport-fit=cover" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://dealerhinojakarta.co.id/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://dealerhinojakarta.co.id/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:217.21.72.151 include:mailchannels.net include:relay.mailchannels.net +a +mx ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved