seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
http://craftsbazaar.com/crafts-of-india
Your general SEO Checkup Score
Archived
77/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 77 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
1 Warnings
32 Passed
Common SEO issues
Score: 66
Failed: 4
Warnings: 0
Passed: 11
Google Search Results Preview
Desktop version
https://www.craftsbazaar.com/usd/CraftsBazaar | Exclusive Arts and Crafts Bazaar for Vintage, Heritage, Handmade Unique Online Home and Living ProductsCraftsBazaar provides instant access to buy exclusive Indian handmade products, handicrafts and artifacts online directly from artisans. Shop from sarees to kutis and lehengas. Shop for Indian Spices, Herbs, Teas, Chocolates and more. Explore all Indian arts, crafts and artisans story.
Mobile version
https://www.craftsbazaar.com/usd/CraftsBazaar | Exclusive Arts and Crafts Bazaar for Vintage, Heritage, Handmade Unique Online Home and Living ProductsCraftsBazaar provides instant access to buy exclusive Indian handmade products, handicrafts and artifacts online directly from artisans. Shop from sarees to kutis and lehengas. Shop for Indian Spices, Herbs, Teas, Chocolates and more. Explore all Indian arts, crafts and artisans story.
Keywords Cloud
accessoriesangelaparnaapparelartisansbagsbazaarbeadsblackbordersbraceletsbuddhabukharacarpetcartchallucoastercollectioncommentscontinuecottoncoverscraftcraftscraftsbazaarcushioncustomersdelivereddesignerdirectdiscountdrawdupattasearpiecesembroideryenjoyenterfigurinesfloralfoodsfreegiftsgoldgreenhairhandhandmadehangingheritagehomeindiaindianjewelleryjoinjumbokanthakashmiriknowleatherlinenmadhubanimetalnaduonlineordersoverseaspaintingspasswordpostedpotterypriceproductproductsrafflereadingregularsalesareesseasonsselectsetsshawlsshipshippingsignsilksimplyspecialspicesstolestabletamiltikulitimetraditionalviewwallwoodwoollenzardozi
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
SEO Friendly URL Test
  • We have found 203 URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage has 240 'img' tags and 161 of them are missing the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 485 inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Check
Speed optimizations
Score: 69
Failed: 3
Warnings: 1
Passed: 7
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 641.32 Kb to 58.08 Kb (91 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 8.179 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 267
  • 7 HTML Pages
  • 18 CSS Files
  • 51 JS Files
  • 191 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Your URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We found 3 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 7
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 +a +mx +ip4:37.60.239.145 +ip4:108.163.228.172 +a:delivery.mailspamprotection.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved