seo site checkup logo
PricingFree ToolsArticles
Report generated 8 months ago
https://cozmo.jo
Your general SEO Checkup Score
Archived
59/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 59 out of 100, which is below the average score of 75. However, there are 22 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
22 Failed
6 Warnings
46 Passed
Issues to fix
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Use an absolute URL in the canonical link tag to show precisely which URL is preferred, without ambiguity.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 63
Failed: 5
Warnings: 3
Passed: 18
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 5 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: COZMO
Length: 5 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Shop online at Cozmo for everything from groceries to toys, and use THE Group’s very own loyalty program that offers our customers a high range of exclusive offers and discounts from our partners.
Length: 196 characters
Google Search Results Preview Test
Desktop version
https://cozmo.jo/COZMOShop online at Cozmo for everything from groceries to toys, and use THE Group’s very own loyalty program that offers our customers a high range of exclusive offers and discounts from our partners.
Mobile version
https://cozmo.jo/COZMOShop online at Cozmo for everything from groceries to toys, and use THE Group’s very own loyalty program that offers our customers a high range of exclusive offers and discounts from our partners.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
10list6create6password5phone4account
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
list
create
password
phone
account
Keywords Cloud Test
accountalternativealternativesavailablebabybakerybeginningbutcherybuttercancelcapitalcardcarecarrotscartcategoriescharacterschoosechosencodecoffeecreatecupboardcupsdairydefineddelidigitdisplaydrinksediteggsemailenterfoodforgotfreshfrozenfruitsgingergratedhavehomehomewarehouseholdincludingjordaniankidslaundryletterlikelistlistsnumbernumbersoffersonionpasswordpersonalpetsphoneproductproductsquantityregisterreplaceresendresetresultssavesearchsendshoppingsignsimilarslicedsoftspecialstocksymboltablespoonsthinlytoysvegetablesviewzero
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test8% of top 100 sites passed
  • This webpage is not using inline CSS styles.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 50
Failed: 10
Warnings: 3
Passed: 12
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,414 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 2411.78 Kb to 153.73 Kb (94% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 23.91 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
83.5 %
11.04 Mb
javascript
11.6 %
1.54 Mb
other
2.3 %
306.54 Kb
html
1.8 %
249.55 Kb
css
0.7 %
97.82 Kb
font
0.0 %
0 B
TOTAL
100%
13.22 Mb
Requests by content type
Content type
Percent
Requests
image
82.6 %
223
javascript
12.2 %
33
css
4.1 %
11
other
0.7 %
2
html
0.4 %
1
font
0.0 %
0
TOTAL
100%
270
Content size by domain
Domain
Percent
Size
cozmo.jo
96.6 %
12.77 Mb
googletagmanager.com
2.0 %
275.96 Kb
connect.facebook.net
0.4 %
57.88 Kb
d2r1yp2w7bby2u.cloudfront.net
0.3 %
43.47 Kb
gstatic.com
0.3 %
39.69 Kb
cdnjs.cloudflare.com
0.2 %
26.74 Kb
cdn.jsdelivr.net
0.1 %
13.86 Kb
s3-eu-west-1.amazonaws.com
0.0 %
2.18 Kb
eu1.clevertap-prod.com
0.0 %
840 B
TOTAL
100%
13.22 Mb
Requests by domain
Domain
Percent
Requests
cozmo.jo
94.4 %
255
cdnjs.cloudflare.com
1.1 %
3
googletagmanager.com
1.1 %
3
gstatic.com
1.1 %
3
d2r1yp2w7bby2u.cloudfront.net
0.7 %
2
cdn.jsdelivr.net
0.4 %
1
s3-eu-west-1.amazonaws.com
0.4 %
1
eu1.clevertap-prod.com
0.4 %
1
connect.facebook.net
0.4 %
1
TOTAL
100%
270
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
See results list
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.210 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.21 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.395 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.395 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.25 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.25 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://cozmo.jo/imagesCozmo/img/logoCOZMO.svg" class="img-fluid" alt="Logo">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0862. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0862

0.1

0.25

DOM element which contributes the most to CLS score:
Text: All Products Jordanian Products Fruits & Vegetables Bakery Butchery Deli D...
Html: <div class="wrapper container-page funDisplay">
Score: 0.0837
Server and security
Score: 79
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "cozmo.jo" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.cozmo.jo
Subject Alternative Names (SANs)
cozmo.jo, www.cozmo.jo
Not valid before
Mon, September 9o 2024, 8:48:45 am (z)
Not valid after
Sun, December 8o 2024, 8:48:44 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R10
Intermediate certificate
Common name
R10
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test82% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
Server: nginx/1.24.0
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 23
Failed: 4
Warnings: 0
Passed: 6
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag but the specified "href" attribute contains a relative path. The point of a canonical tag is to state precisely which URL is preferred, without ambiguity and this is best achieved by using absolute URLs.
<link href="#" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.protection.outlook.com -all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=UTF-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved