seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.constructionworld.in
Your general SEO Checkup Score
Archived
66/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 66 out of 100, which is below the average score of 75. However, there are 16 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
16 Failed
4 Warnings
46 Passed
Common SEO issues
Score: 75
Failed: 4
Warnings: 2
Passed: 19
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: CW | Construction World | India's Premium Magazine, Latest News
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Construction World | India's Premium Magazine, Latest Infrastructure News & Construction Insights in India | Get the latest news on infrastructural updates
Google Search Results Preview Test
Desktop version
https://www.constructionworld.inCW | Construction World | India's Premium Magazine, Latest NewsConstruction World | India's Premium Magazine, Latest Infrastructure News & Construction Insights in India | Get the latest news on infrastructural updates
Mobile version
https://www.constructionworld.inCW | Construction World | India's Premium Magazine, Latest NewsConstruction World | India's Premium Magazine, Latest Infrastructure News & Construction Insights in India | Get the latest news on infrastructural updates
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://www.constructionworld.in/
og:title
CW | Construction World | India's Premium Magazine, Latest News
og:description
Construction World | India's Premium Magazine, Latest Infrastructure News & Construction Insights in India | Get the latest news on infrastructural updates
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
108partner106construction46india44read41world
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
advancedagrawalapproachassociationawardsbudgetbuildbuildingcementcitiescitycollaborationconclaveconstructioncostcroredemanddesigndigitaleconomyenergyengineeringequipmentestateeventsfocusgiridhargoldgreengrowthguptahavehelphighwayhighwaysimproveindiaindustryinfrastructurekoshykumarlatestleanleveraginglikemaharashtrametrominingmoderatormumbainewsnoteoctoberopportunitypadodepanelistspartnerpartnersperformanceplanplantsplayerspolicypoweredpratappresentingprevproductionprofprojectprojectsqualityrailrailwaysrajagopalanreadrealroadroadssectorserviceshrisilversinghsmartspeakerssteelsubscribesupportingtechnologiestechnologytimevarghesewaterwebinarwelcomeworkworldyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
ANNUAL ISSUE
H2 tags
Kochi water metro services to start in September
Railways freight transport up 8.25% as it carries more coal
Centre requests Rs 220 billion from EFC for 900-km Ladakh power link
Maharashtra nod for NMC’s proposal to upgrade STPs
Soon, Mumbai-Nagpur highway to be operational
PMC to rope in private agency to help keep city clean
Delhi: Airport express line to get 2 km extension
Latest News
SJVN secures 200 MW solar project in Maharashtra for Rs 12 billion
Rajasthan calls HPCL to expedite refinery work
BPCL sees Rs 61.48 billion loss in Q1
Mining projects financing to boost as Great Barrier Reef recovers
Tata Motors to acquire Ford India's Sanand plant
Multi-modal Logistics Park to be awarded in Chennai
Lodha Group purchases prime land parcel in Pune
East Central Railways grants LOA to Ashoka Buildcon
Infrastructure updates
Get latest news delivered daily!
Three railroad projects proposed under PM GatiShakti for reliable logistics
CapitaLand to raise $2 billion to $3 billion India-focused office fund
Invest India, Infrastructure Asia tie-up on capacity building
Div Com Jammu stamps approval to 28 revised projects
NHSRCL finishes 75 km pier work of MAHSR
UP CM dedicates infra projects worth Rs 145 crore to Azamgarh
Chenab Railway Bridge headed for a golden joint
Latest Events
THE ILCC 2021 OPPORTUNITY & LEAN CONSTRUCTION BENEFITS
Welcome Note
Speakers
Construction Technology Summit 2022
The CW Design Build Conclave & Awards 2022
Partners
Unlocking AI & ML in the Construction Sector
Manufacturing Production Machinery Performance Engineering : Simcenter
Construction World Design – Build Conclave & Awards
Infrastructure sector ready for disruption
Moderator
Partner
The World's Best Abrasion-Resistant Steel For Mining Operations
Presenter
Cement Expo 2021
Panelists
Make In Steel
CW Budget 2021
Technological advancements towards reduction of emissions in cement plants by Indian Cement Review
Constructible BIM for AEC: The future is connected construction
Cost Optimisation in Construction
Leveraging Technology for Collaboration and Control in Roads & Highways projects
Precast & Prefab Technology
ADOPT AI & REALIZE ROI
CWAB Awards 2022
Smart Urbanation 2022
8th INDIA CONSTRUCTION FESTIVAL 2022
Annual Issue
How ecommerce is driving growth for warehousing and logistics
Latest Premium Articles
Trailer Maintenance Tips
LANXESS’ MPP BU turnover multiplies almost four times in 10 years
What led to a month-long break for ceramic tile manufacturers?
Pros and cons of glass facades
Nagpur Smart City: The next big opportunity for big players
Tony of Atlas Copco: We have a good mix of compressors in our diesel range
Real Estate Updates
About 2.5 crore houses sanctioned under PMAY-G!
Karnataka’s new R&D policy aims to boost research at all levels
Kolkata Municipal Corporation engineers to monitor infra projects
BUDA to start work on Kanabargi residential layout project in Nov
Mohit Malhotra resigns as GPL’s CEO and Managing Director
Tech Updates
3D maps announced for Indian cities
L&T and Amazon Data Services sign a 21.5-year lease for 5.5 acre
The development of Kerala's Infopark is slated for 100 acres
Building Material Prices
Videos
Podcast
Interviews
Flexiflow MD: We plan to expand our footprint outside India
Exclusive! World’s largest passenger elevator is here in India
Here’s how the 4D model can help the construction industry
S Agarwal of ACE: We plan to double our production capacity
Kim of Doosan Bobcat: The market for skid steer loader is slowly pro..
Trimble: On making construction efficient as manufacturing
Mukutban plant is among the most advanced cement plants: Birla Corp
UP to have metros in 8 to 10 cities in the near future: Kumar Keshav
The future shall demand less energy intensive greener cements
BKT aims for 10% of India’s market share of highway tyre manufactu..
Digital Edition
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • We've found JavaScript errors on your webpage!
See results list
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Google Plus Twitter 
Speed optimizations
Score: 52
Failed: 8
Warnings: 2
Passed: 10
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 22,798 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 955.44 Kb to 79.12 Kb (92% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 13.68 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds. When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
image
70.3 %
6.23 Mb
javascript
16.7 %
1.48 Mb
other
8.8 %
795.65 Kb
html
2.2 %
200.35 Kb
css
1.3 %
114.80 Kb
font
0.7 %
62.66 Kb
TOTAL
100%
8.86 Mb
Requests by content type
Content type
Percent
Requests
image
56.0 %
253
other
24.1 %
109
javascript
12.4 %
56
html
5.1 %
23
css
1.8 %
8
font
0.7 %
3
TOTAL
100%
452
Content size by domain
Domain
Percent
Size
constructionworld.in
68.5 %
6.07 Mb
cf-hls-media.sndcdn.com
5.3 %
482.32 Kb
tpc.googlesyndication.com
5.1 %
462.44 Kb
widget.sndcdn.com
4.2 %
376.89 Kb
securepubads.g.doubleclick.net
3.6 %
330.03 Kb
googletagmanager.com
2.7 %
247.73 Kb
connect.facebook.net
1.2 %
110.67 Kb
translate.googleapis.com
1.1 %
95.67 Kb
i.ytimg.com
1.0 %
93.29 Kb
cdnjs.cloudflare.com
0.9 %
82.03 Kb
Other
6.4 %
578.22 Kb
TOTAL
100%
8.86 Mb
Requests by domain
Domain
Percent
Requests
constructionworld.in
54.0 %
244
securepubads.g.doubleclick.net
9.1 %
41
api-widget.soundcloud.com
6.4 %
29
cf-hls-media.sndcdn.com
4.0 %
18
google.com
2.9 %
13
google-analytics.com
2.4 %
11
tpc.googlesyndication.com
1.8 %
8
pagead2.googlesyndication.com
1.8 %
8
i.ytimg.com
1.3 %
6
widget.sndcdn.com
1.3 %
6
Other
15.0 %
68
TOTAL
100%
452
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Your URL performed 2 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 77
Failed: 2
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.constructionworld.in" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.constructionworld.in
Subject Alternative Names (SANs)
*.constructionworld.in, constructionworld.in
Not valid before
Tue, February 1o 2022, 12:00:00 am (z)
Not valid after
Wed, February 1o 2023, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 59
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 include:zcsend.net ~all
Ads.txt Validation Test80% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=UTF-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved