seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://citylane.ch
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 18 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
18 Failed
6 Warnings
49 Passed
Issues to fix
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
To enhance website performance, it is recommended to implement a caching mechanism that delivers static HTML content.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 62
Failed: 8
Warnings: 1
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 78 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Flughafentransfer & Limousinenservice in der Schweiz – Komfort & Pünktlichkeit
Length: 78 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Citylane bietet zuverlässigen Flughafentransfer und Limousinenservice in der Schweiz. Pünktlich, sicher und professionell. Jetzt einfach online buchen!
Length: 151 characters
Google Search Results Preview Test
Desktop version
https://citylane.ch/Flughafentransfer & Limousinenservice in der Schweiz – Komfort & PünktlichkeitCitylane bietet zuverlässigen Flughafentransfer und Limousinenservice in der Schweiz. Pünktlich, sicher und professionell. Jetzt einfach online buchen!
Mobile version
https://citylane.ch/Flughafentransfer & Limousinenservice in der Schweiz – Komfort & PünktlichkeitCitylane bietet zuverlässigen Flughafentransfer und Limousinenservice in der Schweiz. Pünktlich, sicher und professionell. Jetzt einfach online buchen!
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Flughafentransfer & Limousinenservice in der Schweiz – Komfort & Pünktlichkeit
og:url
https://citylane.ch/
og:site_name
citylane.ch
og:description
Citylane bietet zuverlässigen Flughafentransfer und Limousinenservice in der Schweiz. Pünktlich, sicher und professionell. Jetzt einfach online buchen!
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
25oder20sehr15service15pünktlich12buchen
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
oder
sehr
service
pünktlich
buchen
Keywords Cloud Test
abholungaktivalessandroauchbabybabysitzbenötigenbequembietenbringenbuchenbuchungchauffeurchauffeurservicecitylanedeinedeinerdenktdichdiesedirektegaleineeineneinfacheinwandfreienempfehlenextrafahrdienstfahrerfahrtfahrtenfahrzeugfahrzeugeflughafenflughafentransferfragenfreundlicherganzengarantiertgernehomeihnenihreihrenjederzeitjetztkannkeinkeineklassekomfortkompetentkontaktkundenkurzlaneleistungmariomercedesnachnachgefragtnichtnochmalsnotburgaoderohneonlinepreispreiseprivatpünktlichsehrsellittoservicesichsichersicheresindstadtstimmtstundentimpanarotransfertrustpilotumwegeunserunsereunserenunternehmenweiterempfehlenwelchenwhatsappwurdezielzimmermannzuverlässigzürichüberüberraschungen
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Unsere Kunden schätzen:
Flughafentransfer Zürich – pünktlich, zuverlässig & fix Preise
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta charset="utf-8"
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 60
Failed: 8
Warnings: 3
Passed: 14
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,215 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1048.55 Kb to 171.86 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 8.86 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 2 seconds!
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
52.6 %
1.21 Mb
font
20.1 %
474.90 Kb
image
15.8 %
374.59 Kb
html
8.0 %
188.20 Kb
css
3.4 %
81.26 Kb
other
0.0 %
1020 B
TOTAL
100%
2.31 Mb
Requests by content type
Content type
Percent
Requests
javascript
40.0 %
44
image
30.9 %
34
css
10.9 %
12
font
9.1 %
10
html
5.5 %
6
other
3.6 %
4
TOTAL
100%
110
Content size by domain
Domain
Percent
Size
onecdn.io
42.4 %
1001.75 Kb
app.citylane.ch
27.4 %
647.37 Kb
googletagmanager.com
15.8 %
374.18 Kb
citylane.ch
7.2 %
170.10 Kb
maps.googleapis.com
5.4 %
127.94 Kb
fonts.gstatic.com
1.5 %
34.39 Kb
googleads.g.doubleclick.net
0.2 %
4.59 Kb
fonts.googleapis.com
0.1 %
2.02 Kb
td.doubleclick.net
0.0 %
823 B
google.com
0.0 %
649 B
TOTAL
100%
2.31 Mb
Requests by domain
Domain
Percent
Requests
onecdn.io
50.0 %
55
app.citylane.ch
32.7 %
36
googletagmanager.com
4.5 %
5
citylane.ch
2.7 %
3
google.com
2.7 %
3
maps.googleapis.com
1.8 %
2
td.doubleclick.net
1.8 %
2
googleads.g.doubleclick.net
1.8 %
2
fonts.googleapis.com
0.9 %
1
fonts.gstatic.com
0.9 %
1
TOTAL
100%
110
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • It doesn't appear that this website is caching webpages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.254 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.254 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.985 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.985 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.75 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.75 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img class="blur-up lazyautosizes ls-is-cached lazyloaded" src="https://onecdn.io/media/271be1c6-d8de-4e69-a634-91..." data-srcset="https://onecdn.io/media/271be1c6-d8de-4e69-a634-91..." alt="" data-sizes="auto" draggable="false" sizes="1920px" srcset="https://onecdn.io/media/271be1c6-d8de-4e69-a634-91...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0005. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0005

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0005
Server and security
Score: 81
Failed: 2
Warnings: 1
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using the HTTPS protocol, but the SSL Certificate will expire in less than a month! Having an up-to-date certificate is an important security practice to ensure that your website is safe and provides trust, and any communication between the user's browser and your website (such as passwords, credit cards, or forms) is encrypted and private.

The certificate is not used before the activation date.

The certificate will expire in less than a month!

The hostname "citylane.ch" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
citylane.ch
Subject Alternative Names (SANs)
citylane.ch, www.citylane.ch
Not valid before
Thu, March 6o 2025, 12:00:00 am (z)
Not valid after
Wed, June 4o 2025, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
ZeroSSL RSA Domain Secure Site CA
Intermediate certificate
Common name
ZeroSSL RSA Domain Secure Site CA
Organization
ZeroSSL
Location
AT
Not valid before
Thu, January 30o 2020, 12:00:00 am (z)
Not valid after
Tue, January 29o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=2592000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1,maximum-scale=1,user-scalable=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://citylane.ch/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://citylane.ch/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 redirect=spf.mail.hostpoint.ch
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved