seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://cherryduck.com/work/filter/events-live-streaming
Your general SEO Checkup Score
Archived
82/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 82 out of 100, which is higher than the average score of 75. Our analysis has identified 5 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
5 Failed
1 Warnings
35 Passed
Common SEO issues
Score: 85
Failed: 2
Warnings: 0
Passed: 14
Google Search Results Preview Test
Desktop version
https://cherryduck.com/work/filter/events-live-streamingLush - Lush Summit 2017Cherryduck - The one-stop shop for video content - Campaigns - Live Streaming - Animation We have everything you need to tell your brand story here under one roof: Creatives, Producers, Directors, Editors, Animators, Camera Operators and everything in-between, all sitting next door to our very own Cherryduck Studios - 21,000 sq. ft. of fully-equipped creative space. And because we have everything on-hand we can deliver quantity, quality and cost-efficiency. So when it seems impossible...let's have a chat.
Mobile version
https://cherryduck.com/work/filter/events-live-streamingLush - Lush Summit 2017Cherryduck - The one-stop shop for video content - Campaigns - Live Streaming - Animation We have everything you need to tell your brand story here under one roof: Creatives, Producers, Directors, Editors, Animators, Camera Operators and everything in-between, all sitting next door to our very own Cherryduck Studios - 21,000 sq. ft. of fully-equipped creative space. And because we have everything on-hand we can deliver quantity, quality and cost-efficiency. So when it seems impossible...let's have a chat.
Keywords Cloud Test
addressanimationasosawardawardsblogbrowsebrowserbrowsersbuildcampaignscatwalkscentrallylocatedcertifiedchallengechatcherryduckchoicechromeclientsclosecomecompanycontactcontentdaviddeepdesigneddirectorsemaileventsfacebookfail....sorryfiestafocusfollowfordgamegooglehappenedhappyhashtaghelphere'shirejobhoursinstagraminterest?livelatestlet'slinkedinlivelondonlushmagazinemodernmusicnumberopportunitiesperformancephoneplatformpreferproduceproductproductionproductioncreativeequipmentprojectsrandomrightsampsonshortlistshortlyshowssitesorryspecialistsstreamstreamingstreamingstudiospoststreamsstudiosstylistsuresurnameteamthanksto...craigtouchtutorialstwitchtwitterupdateviewwe'llwe'vewebsitewinningworkworkedyoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage has 1 'img' tags and none of them contain the required 'alt' attribute.
See full list
Inline CSS Test
  • Your webpage is using 7 inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your web page.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using: Facebook; Twitter;
Speed optimizations
Score: 78
Failed: 2
Warnings: 1
Passed: 8
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 19.10 Kb to 4.19 Kb (78 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 1.94 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Congratulations, your page has fewer than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from your server, which will ultimately slow down the loading of your web page.
Total Objects: 19
  • 1 HTML Pages
  • 1 CSS Files
  • 4 JS Files
  • 13 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Your URL performed one redirect! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 0
Warnings: 0
Passed: 5
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your page does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 include:_spf.google.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved