seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
https://chabsons.com/web/home
Your general SEO Checkup Score
Archived
43/100
SEO Score
Average SEO score of top 100 sites: 75%
Unfortunately, this website received an SEO score of 43 out of 100, which is significantly lower than the average score of 75. Our analysis has identified 22 important issues that need to be addressed urgently to improve your website's performance and avoid further damage to your search engine visibility.
22 Failed
2 Warnings
28 Passed
Common SEO issues
Score: 42
Failed: 9
Warnings: 1
Passed: 11
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Chabsons :: Welcome to wellness zone..
Meta Description Test
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview Test
Desktop version
https://chabsons.com/web/homeChabsons :: Welcome to wellness zone..
Mobile version
https://chabsons.com/web/homeChabsons :: Welcome to wellness zone..
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
17mount15wall12accessories12shower11floor
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
abstractaccessoriesacrylicapplicatorsartificialbalconybasinbathbathroombathroomsboardbodybowlcancelceilingceramiccitycladdingcoldconcconcealedcontactcontrollercountercustomizeddesignerdivertordoubledrainboardemailenquiryepoxyexteriorfaucetsfloorflooringfloorsflowflushingfreegeysersgodsgrassgrouthandhighinletinstantkidskitchenlaminatemixermodernmountmountedmultinatureoffersoutdooroutletpartspasswordpipesplankporcelainpressurequartzroadsanitarywaresearchsensorsherashowershowersshowroomsignsinglesinkssolidspoutstainlesssteelstonestonesstoresurfacestablethicktiletilestoweluncoloredurinalusernamevalvevitrifiedwallwallpaperswashwood
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your webpage does not contain any H1 headings. H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our newĀ Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator fromĀ SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Your webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Your website is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 29
Failed: 9
Warnings: 1
Passed: 6
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 89% - from 136.52 Kb to 14.37 Kb .
Site Loading Speed Test
  • Your website loading time is around 9.85 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 150
  • 1 HTML Pages
  • 6 CSS Files
  • 12 JS Files
  • 131 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is not serving all resources (images, javascript and css) from CDNs.
See results list
Image Caching Test
  • Your website is not using cache headers for your images. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Caching Test
  • Your website is not using cache headers for your JavaScript resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
CSS Caching Test
  • Your website is not using cache headers for your CSS resources. Setting cache headers can help speed up the serving of your webpages for users that regularly visit your site.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your webpage's CSS resources are not minified.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 54
Failed: 3
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Apache/2.4.6 (CentOS) OpenSSL/1.0.1e-fips mod_fcgid/2.3.9 PHP/5.4.16
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 6
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF Records Test
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 a mx include:websitewelcome.com ~all
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved