seo site checkup logo
PricingFree ToolsArticles
Report generated 8 days ago
https://boostsante.com
Your general SEO Checkup Score
Archived
75/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 75 out of 100, which is the same as the average score of 75. Our analysis has identified 13 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
6 Warnings
54 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 57
Failed: 5
Warnings: 4
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 68 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Shop Personal Care, Beauty, Health, & Wellness Products - BoostSante
Length: 68 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 7 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: On Sale
Length: 7 characters
Google Search Results Preview Test
Desktop version
https://boostsante.com/Shop Personal Care, Beauty, Health, & Wellness Products - BoostSanteOn Sale
Mobile version
https://boostsante.com/Shop Personal Care, Beauty, Health, & Wellness Products - BoostSanteOn Sale
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
Shop Personal Care, Beauty, Health, & Wellness Products - BoostSante
og:description
On Sale
og:url
https://boostsante.com/
og:site_name
BoostSante
og:updated_time
2025-05-07T16:10:30+03:00
og:image
https://boostsante.com/wp-content/uploads/2023/09/LogoBoostSante.webp
og:image:secure_url
https://boostsante.com/wp-content/uploads/2023/09/LogoBoostSante.webp
og:image:width
1920
og:image:height
594
og:image:alt
Boostsante Logo
og:image:type
image/webp
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
81cart48price24original24current18free
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
cart
price
original
current
free
Keywords Cloud Test
actiaftersunakadiaambassadorantibelleviebetterbiorepairbiotinblanxbleedingboxesbrandsbrownbundlecarecarinacartchosencleanserclearcocococobrowncollagencoursecurecurrentdeliveryericessentialfacefavrefreeglowinggumshairhealthyherbshydrolysedinsidelebanonlifelotionmarinematchamonthmouthwashmultiplemusclemuscletechnailsnaturalnutricheveuxnutritechofferoffersoptionsoralordersoriginaloutsidepackpageperfectionistpluspowderpriceproductprogramprotectionproteinpureratedrejuveareliefremovalselectserumshippingshopskinskincaresoothingsportstainsupplementsupplementstanningteethtoothpastetypesvariantsviewvitaminvitaminswheywhitewhiterworldwideyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
3 Pure Collagen Plus + 3 Nutricheveux + 1 Pure Collagen Plus Free At 10% off
Akadia Vitamin Hair Serum( 1+1 for free)
Carina Cure Hair Bundle
Nutricheveux 3 month bundle + Akadia vit C Hair Serum for hair loss free
Pure Collagen plus 1 month course + Akadia vitamin C face serum free At 10% off
Rejuvea Perfectionist HA Serum + Pharma Roller Free At 20% Off
Cocobrown Bundle- Aftersun Lotion & Tanning Oil
Matcha Offer
Blanx Stain Removal Kit For Whiter Teeth
CocoBrown AfterSun Lotion for Pure Soothing Relief
CocoBrown Tanning Oil for Golden Brown Tan
Actifloa plus ( 6 boxes/ full course 3 months)
PURE WHITE + Glowing Outside From The Inside X4
ECLA Jeunesse – Premium Formula for Youthful Glow
Carina Cure LeaveIn Conditioner
Carina Cure Hair Oil
Carina Cure Rosemary Hair Mask
PURE WHITE + Glowing Outside From The Inside.
BelleVie Nutricheveux Shampoo | Growth & Vitality
Natural Herb’s Facial Cleanser
Matcha X2 + Free Cup Offer
Akadia Micellar Water + Face Foaming Cleanser + Face Washing Head Band
DA BEAUTY Glass Skin Serum SPF 50
Pure Collagen Plus Marine Hydrolysed Collagen Protein Types I & III – 1 Month Course
Nutricheveux Biotin 5000mcg, For Healthy Hair, Skin and Nails 3 Month Pack
Actiflora plus ( 2 boxes / one month course)
Pure Collagen Plus Marine Hydrolysed Collagen Protein Types I & III – 3 Month Course
ActiHeme Iron Supplement for All Types of Anemia
ActiVit Forte Essential Multivitamin Supplement
MATCHA- Gluten free, Natural, Vegan Green Tea Leaves for Better Wellbeing
BlanX Black Charcoal Natural Active Carbon Toothpaste for whiter smile 75 ml
Biorepair® Mouthwash Gum Protection for Bleeding Gums
Actual Condom Delay Retard
Blanx Intensive Stain Removal Perfect for Coffee Lovers and Smokers
Biorepair® Kids Toothpaste from 0 to 6 years old
Biorepair® Plus Parodontgel For Bleeding Gums
Nutricheveux Biotin 5000mcg, For Healthy Hair, Skin and Nails 6 Month Pack
Actijoints Collagen Type II for Joint Pain Relief & Support
B-Immune (60 capsules)
Akadia Foaming Cleanser for Clear Skin
Rejuvea Essential Vitamins Daily Serum Radiating Skincare
Rejuvea HA Bright Illuminating Anti-Aging Skincare Cream
Rejuvea HA Eye Contour Multi Active Moisturizer and Anti-Aging Eye Contour Serum
Rejuvea Perfectionist HA Pure Anti-Wrinkles Serum
Rejuvea Vitamin A Serum Anti-Wrinkle Skincare
Blanx Nordic White-Regenerating,Soothing, & Whitening Toothpaste
Blanx Whitening Non-Abrasive Toothpaste 75 ml
Biorepair Desensitizing Gel- Repair Shock treatment
Biorepair Pro white for a Better Smile
Biorepair® Plus Sensitive for Sensitive Teeth
Biorepair® Mouthwash Triple Action-12 Sticks-Travel Pack
Biorepair® Plus Total Protection for Healthier Teeth
Biorepair® Junior Toothpaste from 6 to 12 years old
Biorepair Unwaxed Spongy Dental Floss
Biorepair Unwaxed Ultra Flat Dental Floss
DYMATIZE ISO 100 Isolate Whey Protein Powder (2.3 kg)
Eric Favre Iso Zero Whey Protein Powder for Lean Muscle Gain (2 kg)
Gold Standard Whey Protein Powder for Muscle Gain (2.26 kg)
NITROTECH Whey Protein Powder (1.81 kg)
NUTRITECH AMINO BOOST 2.0 for Muscle Recovery & Growth
NUTRITECH Creatine Monohydrate Powder for Explosive Power
NUTRITECH Premium Whey Protein Powder (2 KG)
RSP Micronized Creatine Powder for Better Performance (300 g)
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
https://boostsante.com/robots.txt
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
https://boostsante.com/sitemap_index.xml
SEO Friendly URL Test29% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 74
Failed: 6
Warnings: 1
Passed: 18
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 3,122 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 391.78 Kb to 36.08 Kb (91% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.18 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
52.9 %
1.37 Mb
javascript
31.6 %
836.53 Kb
font
6.4 %
169.42 Kb
css
5.7 %
151.14 Kb
html
2.5 %
66.57 Kb
other
0.8 %
21.60 Kb
TOTAL
100%
2.58 Mb
Requests by content type
Content type
Percent
Requests
image
37.0 %
34
javascript
28.3 %
26
css
23.9 %
22
font
5.4 %
5
other
3.3 %
3
html
2.2 %
2
TOTAL
100%
92
Content size by domain
Domain
Percent
Size
boostsante.com
68.8 %
1.78 Mb
gstatic.com
14.1 %
371.74 Kb
connect.facebook.net
7.0 %
184.13 Kb
googletagmanager.com
3.7 %
96.91 Kb
fonts.gstatic.com
3.2 %
84.81 Kb
google.com
2.4 %
62.93 Kb
webvue.net
0.8 %
21.75 Kb
fonts.googleapis.com
0.1 %
1.50 Kb
facebook.com
0.0 %
376 B
TOTAL
100%
2.58 Mb
Requests by domain
Domain
Percent
Requests
boostsante.com
82.6 %
76
connect.facebook.net
4.3 %
4
fonts.gstatic.com
3.3 %
3
gstatic.com
2.2 %
2
facebook.com
2.2 %
2
google.com
2.2 %
2
fonts.googleapis.com
1.1 %
1
webvue.net
1.1 %
1
googletagmanager.com
1.1 %
1
TOTAL
100%
92
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.097 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.097 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.226 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.226 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.87 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.87 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="swiper-slide-bg" role="img">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0004. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0004

0.1

0.25

DOM element which contributes the most to CLS score:
Text: SHOP CARE BRANDS VITAMINS & SUPPLEMENTS SPORT SUPPLEMENTS MOM & BABY FOR HIM OFF...
Html: <nav itemscope="" itemtype="http://schema.org/SiteNavigationElement" class="c-top-menu js-top-menu">
Score: 0.0003
Server and security
Score: 97
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "boostsante.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
boostsante.com
Subject Alternative Names (SANs)
boostsante.com
Not valid before
Thu, July 3o 2025, 4:47:52 am (z)
Not valid after
Wed, October 1o 2025, 4:47:51 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
E5
Intermediate certificate
Common name
E5
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1, user-scalable=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://boostsante.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://boostsante.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:zoho.com include:spf.titan.email ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2025 • All rights reserved