seo site checkup logo
PricingFree ToolsArticles
Report generated 4 days ago
https://bensfamilyhomes.com
Your general SEO Checkup Score
Archived
76/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 76 out of 100, which is higher than the average score of 75. Our analysis has identified 15 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
15 Failed
4 Warnings
54 Passed
Issues to fix
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 67
Failed: 7
Warnings: 1
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: KW East Bay Real Estate | Top Bay Area Homes & Expert Agents
Length: 60 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Explore East Bay homes with KW East Bay’s expert agents. Get personalized service, up-to-date market insights, and exclusive listings to buy or sell confidently in the Bay Area.
Length: 177 characters
Google Search Results Preview Test
Desktop version
https://bensfamilyhomes.com/KW East Bay Real Estate | Top Bay Area Homes & Expert AgentsExplore East Bay homes with KW East Bay’s expert agents. Get personalized service, up-to-date market insights, and exclusive listings to buy or sell confidently in the Bay Area.
Mobile version
https://bensfamilyhomes.com/KW East Bay Real Estate | Top Bay Area Homes & Expert AgentsExplore East Bay homes with KW East Bay’s expert agents. Get personalized service, up-to-date market insights, and exclusive listings to buy or sell confidently in the Bay Area.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
KW East Bay Real Estate | Top Bay Area Homes & Expert Agents
og:description
Explore East Bay homes with KW East Bay’s expert agents. Get personalized service, up-to-date market insights, and exclusive listings to buy or sell confidently in the Bay Area.
og:url
https://bensfamilyhomes.com/
og:site_name
Bensfamilyhomes
og:image
https://bensfamilyhomes.com/wp-content/uploads/2025/06/view-luxurious-villa-with-modern-architectural-design-1365x2048.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19home14property9real9estate7search
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
home
property
real
estate
search
Keywords Cloud Test
agentareabelievebelievesbenjaminbensbestblogbreazealebuyingcaliforniachooseclientscommentscommittedcompleteconnectcontactcontentdeliveringdiscoverdisplaydiversedreameasyeffortlesslyemotionalestateexperienceexplorefamilyfreegivingguidancehavehelphelpinghomehomeshouseidealinclusivejourneykellerknowletslevellifestyleslikelistingsmakemarchmarketmenuneighborhoodsofferoptionsperfectpersonalizedpickportfoliopossibleprofessionalprofessionalismproperpropertiespropertyprovideprovidingrealrealtyreceiveremembersavesearchselectselectionsellsellingserviceservicessimplifysituationskipstaffstartsuitablesupportteamtechnologythousandstimetrustvaluationveteranwebsitewidewilliamswonderfulwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
HELPING YOU FIND YOUR DREAM HOME IN THE BAY AREA MARKET
H2 tags
BENJAMIN BREAZEALE
DRE#: 02239052
Get to know us
YOUR HOME JOURNEY MADE EASY
OUR PROPERTIES
Explore & Select Your Homes
FIND THE BEST
Search By Your Interest & Find The Best
All-Inclusive Property Services
Helping You Find the Perfect Home
Are You Ready to Buy Dream House?
Get To Know Benjamin Breazeale
OUR BLOG POST
News & Articles
Explore
Quick Link
Newsletter
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test29% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test75% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 74
Failed: 4
Warnings: 3
Passed: 18
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 29.6 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 498 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 176.45 Kb to 29.6 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 7.21 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
80.1 %
2.05 Mb
javascript
11.6 %
304.40 Kb
css
5.8 %
151.37 Kb
html
1.6 %
43.03 Kb
other
0.8 %
20.79 Kb
font
0.0 %
0 B
TOTAL
100%
2.55 Mb
Requests by content type
Content type
Percent
Requests
javascript
42.6 %
23
css
33.3 %
18
image
11.1 %
6
other
11.1 %
6
html
1.9 %
1
font
0.0 %
0
TOTAL
100%
54
Content size by domain
Domain
Percent
Size
bensfamilyhomes.com
94.9 %
2.42 Mb
googletagmanager.com
5.1 %
133.67 Kb
TOTAL
100%
2.55 Mb
Requests by domain
Domain
Percent
Requests
bensfamilyhomes.com
98.1 %
53
googletagmanager.com
1.9 %
1
TOTAL
100%
54
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.360 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.36 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 2.956 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

2.956 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 3.62 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

3.62 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: BENJAMIN BREAZEALE DRE#: 02239052 HELPING YOU FIND YOUR DREAM HOME IN THE BAY AR...
Html: <section class="elementor-section elementor-top-section elementor-..." data-id="dc66c2d" data-element_type="section" data-settings="{"background_background":"classic"}">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0003. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0003

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Let's Connect
Html: <div class="elementor-element elementor-element-e338e0b elemen..." data-id="e338e0b" data-element_type="widget" data-widget_type="icon-box.default">
Score: 0.0003
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "bensfamilyhomes.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
bensfamilyhomes.com
Subject Alternative Names (SANs)
bensfamilyhomes.com
Not valid before
Thu, June 19o 2025, 3:29:17 pm (z)
Not valid after
Wed, September 17o 2025, 3:29:16 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R11
Intermediate certificate
Common name
R11
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 88
Failed: 2
Warnings: 0
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://bensfamilyhomes.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://bensfamilyhomes.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved